KEGG   Paraburkholderia xenovorans LB400: DR64_1503Help
Entry
DR64_1503         CDS       T03290                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00250  Alanine, aspartate and glutamate metabolism
bxb00410  beta-Alanine metabolism
bxb00430  Taurine and hypotaurine metabolism
bxb00650  Butanoate metabolism
bxb01100  Metabolic pathways
bxb01110  Biosynthesis of secondary metabolites
bxb01120  Microbial metabolism in diverse environments
bxb02024  Quorum sensing
Module
bxb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DR64_1503
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DR64_1503
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DR64_1503
   00430 Taurine and hypotaurine metabolism
    DR64_1503
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DR64_1503
Enzymes [BR:bxb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     DR64_1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIP30593
UniProt: Q144R7
LinkDB All DBs
Position
1:complement(1625876..1627261)
Genome map
AA seq 461 aa AA seqDB search
MTFLKSPPPTPEDVADEYAATISGSSLPKYRIPEASSDRRAVFDLVRDELFMDGNSRQNV
ATFCTTYADDEVRHLMDLSIDKNMIDKDEYPQTAEIEMRCVHMLADLWHASKAWKTTGCS
TTGSSEACMLGGLALKWQWKKRREAQGKPTDKPNFVCGPVQVCWAKFARYFDVEMRQVPL
RGEATGLTPEDLAEYCDENTIGVVATLGITFTCVYEPVKALAGALDALQANVGLDIPIHV
DAASGGFVAPFIQPDLEWDFSVPRVKSINASGHKYGLAPLGVGWVVWRSTQDLPDELIFR
VDYLGGDMPTFALNFSRPAGQIIAQYYMLLRLGREGYRRIQQECADTAQALADGLAKIDQ
LEMIYDGRGALPAVCYKLKHPETAGFTLFDLSDQVRMRGWQIASYELPAGREDTIVQRVL
IRRGVTRDMAAMLLEDIRHAIGHLTKNPVLHSSAGPTFHHN
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgacttttctcaaatcaccaccgcccacgcccgaggacgtcgccgatgaatacgccgcc
acgatctcgggttcatcgctgcccaagtaccggattccggaggcgtcgtccgatcgccgc
gcggtattcgatctggtgcgcgacgaactgttcatggacggcaattcacggcagaacgtc
gcgacgttctgcaccacgtatgccgacgacgaagtgcgccacctgatggatctgtcgatc
gacaagaacatgatcgacaaggacgagtatccgcaaacggcggagatcgaaatgcgctgc
gtgcacatgctcgcggatctgtggcatgccagcaaggcatggaagaccaccggatgttcg
accacgggttcgagcgaggcttgcatgctcggcggtctcgcgctcaagtggcaatggaag
aagcgccgggaagcacagggcaagccgaccgacaagccgaacttcgtgtgcggaccggtg
caggtgtgctgggccaaattcgcccgctacttcgacgtcgagatgcgccaggtgcccttg
cgcggcgaggcaaccgggctgacgccggaagatctggccgagtattgcgacgagaacacg
atcggcgtggtggccacactcggcattaccttcacctgcgtctatgaaccggtgaaggcg
ctggcaggcgcactcgacgcgttgcaagccaatgtcggactcgatattccgattcacgtc
gacgctgccagcggcggcttcgtcgcgccgttcatccagccggacctcgagtgggacttc
agcgtgccgcgcgtgaaatccatcaacgcgtcgggccacaaatacggactcgcgccgctc
ggggtcggctgggtagtctggcgcagcactcaggatctgcccgacgaactgattttccgg
gtcgattatctgggcggcgacatgcccacgttcgcactgaatttctcccgtccggccgga
cagatcatcgcgcagtactacatgctgctgcgcctgggccgcgaaggctaccggcggatc
cagcaggaatgcgccgacaccgcgcaggcgctggccgacgggctggcgaagatcgaccag
ctggaaatgatctacgacgggcgcggcgcgctgccggctgtctgctacaagctgaagcat
ccggaaacagcgggcttcacgctattcgacctgtccgatcaggtccgcatgcgcggctgg
cagatcgcctcgtacgaactgccggcagggcgggaagacaccatcgtgcaacgcgtgttg
atccggcgtggtgtgacgcgcgacatggcggcgatgctgcttgaagacatcaggcacgcc
atcgggcatctgacgaagaatccggtgctgcattcgagcgccggtccgaccttccaccac
aattga

DBGET integrated database retrieval system