KEGG   Paraburkholderia xenovorans LB400: DR64_2116Help
Entry
DR64_2116         CDS       T03290                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00010  Glycolysis / Gluconeogenesis
bxb00620  Pyruvate metabolism
bxb01100  Metabolic pathways
bxb01110  Biosynthesis of secondary metabolites
bxb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bxb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DR64_2116 (acoD)
   00620 Pyruvate metabolism
    DR64_2116 (acoD)
Enzymes [BR:bxb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     DR64_2116 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: AIP29981
UniProt: Q147C9
LinkDB All DBs
Position
1:2319144..2320664
Genome map
AA seq 506 aa AA seqDB search
MNHAEMQFLTTEFPYKKQYANFIGGEWVKPVGGEYFDNVSPITGEAFTSIPRSREADVEL
ALDAAHRAKTAWGKTSAADRANILNRIADRMEANLQRLAVAETIDNGKPLRETTAADIPL
AIDHFRYFAGAVRAQEGSLSEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVLVELIQDLLPPGVLNVVNGFGLEAGKPLASSKRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFADVMNEDDSFFDKALEGFAMFALNQGEV
CTCPSRVLIDEKIYDRFMERALKRVAAITQGHPLDTKTMIGAQASQEQLEKILSYVDLGK
QEGAECLIGGERNALGGELSKGYYVKPTVFRGNNKMRIFQEEIFGPVVSVTTFRNEEEAL
EIANDTLYGLGAGVWTRDGTRAYRFGRQIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSDKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcagagatgcaatttctgaccaccgaattcccgtacaaaaaacagtatgcg
aactttatcggcggcgagtgggtgaagcccgtgggcggcgagtacttcgacaacgtgtcg
ccgatcaccggcgaggcgttcacctcgatcccccgttcgcgtgaagccgacgtcgaactc
gcactggacgccgcgcatcgggcgaaaacggcgtggggcaaaacctcggctgcggatcgc
gcgaatatcctgaaccgcattgccgaccgcatggaagcgaacctgcaacgtctcgccgtg
gccgagacgatcgacaacggcaagccgttgcgcgaaacgacggccgccgacattccgctc
gccatcgatcacttccgctatttcgccggcgccgtgcgggcgcaggaaggctcgctctcc
gagatcgaccacgacacggtggcgtatcactttcatgaaccgctcggcgtagtcggccag
atcattccgtggaatttcccgatcctgatggccgtgtggaagctcgcgcccgcactcgcc
gccggcaactgcgtggtgctcaagcctgccgagcaaacacccgcgtcgatcctcgtgctg
gtggaactgattcaggatttgctgccgccgggcgtgctgaatgtggtcaatggtttcggt
ctcgaagccggcaagccgctggcgtcgagcaagcgtatcgccaagattgcgtttaccggc
gaaaccaccaccgggcgcctgatcatgcagtacgcgagccagaacatcattcccgtcacg
ctcgaactcggcggcaagagcccgaatattttcttcgccgacgtgatgaatgaggacgac
agttttttcgacaaggcgctcgaaggcttcgcgatgttcgcgctgaatcagggcgaggtg
tgtacctgtccgtcgcgcgtattgatcgatgaaaagatttacgaccgcttcatggaacgc
gcgttaaagcgcgtcgcggcgattacgcaggggcatccgctcgacacgaagacgatgatc
ggcgcacaggcctcgcaggagcagctcgaaaaaatcctctcgtatgtggatctcggcaaa
caggaaggcgccgaatgtctgattggcggcgaacgcaatgcgctgggcggtgagttgagc
aaaggctattacgtgaagccgaccgtatttcgcggcaacaacaagatgcgcattttccag
gaagagatcttcggaccggtggtgtcggtcacgactttcaggaacgaagaagaagcgctc
gagatcgccaacgacacgctctacggcctgggcgccggcgtatggacgcgcgacggcaca
cgtgcgtatcgcttcggccggcagattcaggcaggccgcgtgtggaccaactgctatcac
gcctatccggcgcatgcggcgttcggcggctacaagcagtccggcattggccgcgagaat
cacaagatgatgctcgaccattatcagcagaccaagaacctgctcgtcagttatagcgac
aagccgctcggtttcttctaa

DBGET integrated database retrieval system