KEGG   Paraburkholderia xenovorans LB400: DR64_2963Help
Entry
DR64_2963         CDS       T03290                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00020  Citrate cycle (TCA cycle)
bxb00480  Glutathione metabolism
bxb01100  Metabolic pathways
bxb01110  Biosynthesis of secondary metabolites
bxb01120  Microbial metabolism in diverse environments
bxb01130  Biosynthesis of antibiotics
bxb01200  Carbon metabolism
bxb01210  2-Oxocarboxylic acid metabolism
bxb01230  Biosynthesis of amino acids
Module
bxb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bxb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DR64_2963 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DR64_2963 (icd)
Enzymes [BR:bxb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DR64_2963 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIP31729
UniProt: Q13UV2
LinkDB All DBs
Position
1:3244512..3245768
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPTGGDKITVNPDFSLNVSDQPIIPYIEGDGTGIDITPVMIKVVDAAVEKAYA
GKRKIHWMEIYAGEKSTKVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPVREPEKTNMVIFRENSEDIYAGIEWPAESEQAKKIIRF
LREEMGVKKIRFPETSGIGIKPVSREGTERLVRKAIQYAIDHDRRSVTLVHKGNIMKFTE
GAFRDYGYALAQKEFAAELIDGGPWMKIKNPKTGGDVVLKDVIADAFLQQILLRPAEYDV
IATLNLNGDYVSDALAAQVGGIGIAPGANMSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADLIIKSMEKSILQKRVTYDFARLMEGATQVSCSGFGQVLIENL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccgaccggtggtgacaagatcaccgtcaatcccgat
ttctcgctcaacgtgtcggaccagccgatcattccgtacatcgaaggcgacggcaccggc
atcgacatcacgccggtcatgatcaaggtcgtggatgccgctgtggaaaaagcgtatgca
ggcaagcgaaaaatccactggatggaaatctacgccggcgagaaatccaccaaggtgtac
ggcccggatgtgtggctgcccgaagagacgctgcaggtgctcaaggaatatgtcgtctcg
atcaagggcccgctcaccacgccggtgggcggcggcatccgttcgctgaacgtcgcgttg
cgccaggaactggatctgtatgtgtgcttgcggccggtgcagtatttcaagggcgtgcct
tcgccggtgcgcgagccggagaaaaccaacatggtgatcttccgcgagaactcggaagac
atctacgcgggtatcgagtggccggccgaatcggagcaggcgaaaaaaatcatcaggttc
ctgcgcgaagaaatgggcgtgaagaagatccgtttcccggaaacgtcggggatcggcatc
aagccggtgtcgcgtgaaggaacggagcgtctggtgcgcaaggcgatccagtacgcgatc
gaccacgatcgccgttcggtcacgctggtgcacaagggcaacatcatgaagttcaccgaa
ggcgcgttccgcgactacggttacgcgctggcgcaaaaggaattcgccgcggaactgatc
gacggcggcccgtggatgaagatcaagaatccgaaaacgggcggcgacgtcgtcctcaag
gacgtgatcgccgacgcgttcctgcagcagatcctgctgcgtccggctgaatacgacgtg
atcgccacgctgaacctgaatggcgactacgtatcggatgcgttggccgcgcaggtcggc
ggtattggtatcgcaccgggcgcgaatatgtcggattcagtcgcgatgttcgaagccacg
cacggcaccgcgccgaaatacgccggcaaggactacgtgaatccgggctcggaaattctc
tcggcagaaatgatgctgcgccatctcggctggaccgaggcggcggatctgatcatcaag
tcgatggaaaaatcgattctgcaaaaacgcgtcacatacgatttcgcgcgcttgatggaa
ggcgcgactcaggtgtcgtgttccggatttggtcaggtgctgatcgaaaatctgtaa

DBGET integrated database retrieval system