KEGG   Paraburkholderia xenovorans LB400: DR64_3598Help
Entry
DR64_3598         CDS       T03290                                 

Definition
(GenBank) amino ABC transporter, permease , 3-TM region, His/Glu/Gln/Arg/opine family domain protein
  KO
K10009  L-cystine transport system permease protein
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DR64_3598
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bxb02000]
    DR64_3598
Transporters [BR:bxb02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    DR64_3598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AIP31545
UniProt: Q13WL8
LinkDB All DBs
Position
1:3905997..3906674
Genome map
AA seq 225 aa AA seqDB search
MPAWLHLMAQSLWPLLYAGLVFTVPLTLISFAIGLALAFLVALVRLFGPKWAVAIVRFYV
WLFRGSPLLVQLFVIFYGLPNVGIVLDPLTAAIIGFSLNVGAYNSEVIRGVIESIPKGQW
EAAYSMGMTREQALRRAILPQAARVALPPLSNSFIALVKDTSLAAVLTVPEVFQAAQRIA
SVTYEPLILYTEAALVYLVFSSVLSSAQVRLERKFGRHALFHAGN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgccggcatggttgcatctgatggcgcagtcgctgtggcccctgctgtatgcggggctc
gtgttcaccgtgccgctcacgctgatatcgtttgcgatcgggctggcgctcgcgttcctc
gtcgcgctggtgcgtctgttcggaccgaagtgggccgtcgcgatcgtgcgcttctacgtg
tggctgtttcgcggctcaccgttgctcgtgcaactattcgtgatcttctacggattgccg
aacgtgggcatcgtgctcgatccgttgacggcggcgatcatcggcttttcgctgaatgtc
ggcgcgtataactccgaagtgatacgcggtgtgatcgagtcgatcccgaaaggacagtgg
gaagcggcgtattcgatgggtatgacgcgcgagcaggccttgcgtcgcgcgatcctgccg
caagcggcgcgcgttgcgctgccgccgttgtcgaattcgtttatcgctctggtgaaagac
acctcgctcgccgcggtgctgaccgtgcctgaagtgtttcaggcggcgcagcggatcgcg
tcggtgacttacgagccgctgatcctgtacaccgaggcggccctggtttatctggtcttc
agttcggtgttgtcgtcggcgcaggtcaggctcgagcgcaaattcggccgccacgcactt
ttccatgcaggcaactga

DBGET integrated database retrieval system