KEGG   Paraburkholderia xenovorans LB400: DR64_3795Help
Entry
DR64_3795         CDS       T03290                                 

Definition
(GenBank) short chain dehydrogenase family protein
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00061  Fatty acid biosynthesis
bxb00780  Biotin metabolism
bxb01100  Metabolic pathways
bxb01130  Biosynthesis of antibiotics
bxb01212  Fatty acid metabolism
Module
bxb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DR64_3795
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DR64_3795
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DR64_3795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bxb01004]
    DR64_3795
Enzymes [BR:bxb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DR64_3795
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DR64_3795
Lipid biosynthesis proteins [BR:bxb01004]
 Fatty acid synthase
  Component type
   DR64_3795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AIP32165
UniProt: Q13X69
LinkDB All DBs
Position
1:complement(4134049..4134840)
Genome map
AA seq 263 aa AA seqDB search
MGFLAGKRILLTGLLSNRSIAYGIAQACRREGAELAFTYVGERFKDRIKEFAGEFGSDLV
FPCDVADDAQIDALFASLKQHWDGLDGLVHSIGFAPREAIAGDFLDGMTRENFRIAHDIS
AYSFPALAKAAQSMFTPDASLLTLSYLGAERAIPNYNTMGLAKASLEASVRYLAVSLGAK
GVRVNGISAGPIRTLAASGIKGFGKILEFVEQNAPLRRNVTIEQVGNTAAFLLSDLAAGV
TAEIVHVDSGFNAVVGGMAAVAE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcctcgctggcaaacgtatcctgctgaccggcttgttgtcgaaccgctcgatt
gcatacggtatcgcgcaagcctgcaggcgcgaaggcgccgagttggcgttcacctatgtc
ggcgagcgcttcaaggatcgcatcaaggagttcgccggcgaattcggcagcgacctggtg
ttcccctgcgacgtcgccgacgacgcgcagatcgacgccctcttcgcttcactgaagcaa
cactgggacggcctcgacggtctggtccattcgatcggctttgcgccgcgtgaagcgatt
gccggcgatttcctcgacggcatgacgcgcgaaaatttccgcatcgcgcatgacatctcc
gcgtacagcttccccgcgctcgccaaggccgcgcagtccatgttcacaccggacgcgtcg
ttgctcacgctgagctatctcggcgccgagcgcgcaattccaaactacaacacgatgggt
ctcgccaaggcttcgctcgaagcgagcgtgcggtatctggcggtctcgctcggcgccaaa
ggcgtgcgcgtcaacggcatttcggcgggcccgatcaggacgctggctgcgagcggtatc
aagggcttcggcaagattctcgagttcgtcgaacagaatgcgccgctcaggcgcaacgtg
acgatcgaacaggtcggcaacacggcggctttcctgctgtcggatctggcggccggcgtg
accgcggaaatcgtgcacgtcgatagcggcttcaatgcggtggtgggcggcatggctgct
gttgccgagtga

DBGET integrated database retrieval system