KEGG   Paraburkholderia xenovorans LB400: DR64_4103Help
Entry
DR64_4103         CDS       T03290                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
Organism
bxb  Paraburkholderia xenovorans LB400
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIP33841
UniProt: Q13Y18
LinkDB All DBs
Position
1:4453230..4454654
Genome map
AA seq 474 aa AA seqDB search
MKTYEQLYIDGKWIAPCGTGTIDVIDSGTEEIMGRIPEGVEADAESAIAAARVAFDAWAA
TPAAERGEYLRKVAANLKARTDELAGLIAGEVGMPLKLARAIQVGSPVYNWGAYAKLASE
FQYEERVGNSLVVREPVGVVAAITPWNYPLNQVTLKVAAALAAGCTVVLKPSEIAPLTAF
VLAEAIHEAGLPAGVFNLVSGYGPVVGEVLASHPSVDMVSFTGSTRAGKRVSELASATVK
RVALELGGKSASVILDDADFAAAVKGTVSACFLNSGQTCSAHTRMLVPEARYDEARVLAK
QAAETYVAGDPRNETSRLGPLASAAQQARVQQYIAKGIEEGAELVTGGVGLPDGLSKGFF
VKPTVFGRVHPKATIAQEEIFGPVLSILTYKDEEEAVRIANDSPYGLGGAVWAGSDERAV
GIARRIRTGQVDINGGTWNMAAPFGGFKQSGFGRENGVYGLEEYFELKSMQFRV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgtacgagcaactctatatcgatggcaaatggatcgcgccgtgcggcaccggc
acgatcgacgtgatcgactcgggcacggaagagatcatgggccgcattcccgagggagtc
gaggccgatgccgaaagtgcgatcgccgccgcccgcgtggccttcgacgcctgggccgcg
acgcccgccgccgaacgcggcgagtatctgcgcaaggtcgcggcgaacctgaaagcgcgc
acggacgaactggccggtttgatcgccggcgaagtcggcatgccgctaaaactcgcgcgt
gccatccaggtgggcagcccggtctataactggggcgcgtatgcgaagctcgcgagcgag
ttccagtatgaggaacgcgtcggcaattcgctggtggtgcgtgagccggtcggcgtggtg
gcggcgatcacgccgtggaactatccgctcaatcaggtcacgctgaaggtcgcggcggca
ctcgccgcgggttgcacggtggtgctgaagccctcggagatcgcgccgctgaccgcgttc
gtgcttgccgaggcgatccacgaggccgggctgccggccggcgtgttcaacctcgtgagc
ggttatgggccggtggtcggcgaagtgctggcgagccatccgtcggtggatatggtgtcg
ttcaccggctcgactcgcgccggcaaacgggtgtccgagctggcttcggcgacggtcaag
cgcgtcgcgctcgaactcggcggcaagtcggcctcggtcattctcgacgatgcggatttc
gccgcggccgtgaaaggcacggtcagcgcatgctttctgaattccggacagacgtgctcc
gcgcatacgcgcatgctggtgcccgaggcgcgctacgacgaagcgcgcgtgctggcgaag
caggccgccgagacttacgtggccggcgatccgcgcaacgagacgagccgtctcggcccg
ctggcttcggccgcgcagcaggcgcgcgtgcagcaatacatcgcgaaggggatcgaggag
ggcgccgaactggtgacaggcggggtgggtctgcccgatgggttgtcgaagggcttcttc
gtcaagcccactgtgttcggccgcgtgcatcccaaggcgacgatcgctcaggaggaaatc
ttcggcccggtcctgtcgattctgacctacaaggacgaagaggaagccgttcggatcgcc
aacgattcaccgtatggcctgggcggcgcggtatgggccggcagcgacgagcgtgccgtc
ggcattgcgcggcggattcgaaccggtcaggtcgatatcaacggcggcacgtggaatatg
gccgcgccgttcggcggtttcaagcagtcgggattcgggcgcgaaaacggcgtctacggg
ctcgaagagtatttcgaactgaaatccatgcaattcagggtgtga

DBGET integrated database retrieval system