KEGG   Paraburkholderia xenovorans LB400: DR64_4566
Entry
DR64_4566         CDS       T03290                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00440  Phosphonate and phosphinate metabolism
bxb00998  Biosynthesis of various secondary metabolites - part 2
bxb01100  Metabolic pathways
bxb01110  Biosynthesis of secondary metabolites
bxb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DR64_4566 (aepX)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    DR64_4566 (aepX)
Enzymes [BR:bxb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     DR64_4566 (aepX)
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase NAD_binding_7
Other DBs
NCBI-ProteinID: AIP36992
UniProt: Q13Q88
LinkDB
Position
2:complement(123218..124954)
AA seq 578 aa
MNAREPAFISASRSARLRQMLVSNELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQF
GVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADMDEFCGKIKAGKDSQSDENFSIVARVEALIAGWGMDEALR
RAEAYRQAGADAILIHSKLSRPDEILEFAREWAGRGPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAREIHSSETLVNVEDSIAAVNEIFRLQDADEYSEAEDRYLSS
GRAAGSAVVLAASRGKGLEAVTEDRPKVMLPIAGKPLLRWLVDAFKKQGVNDITVVGGYR
ADAIDTAGIKLVVNEQHAQTGELASLACAVDKLAGDTVISYGDLLFRSYILRDLVESEAA
FSVVVDSSLTDAENASVRDFAWCSAADDRGLFGNKVVLRHVSSGQDASSAIASQTPHGRW
VGLLNVRGEGRERLQAVMSQLQARPDFASLDMPALLNALIEAGESIEVQYVHGHWRGVND
LEDFRRAGDFAHAQAPFATAAGGSANSASADAASGAAQ
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgaacgcccgcgaacctgccttcatctccgcttcccgcagcgcgcgcctgcgccagatg
ctcgtcagcaacgaactcgaattcatgatggaggctcataacggcctgtccgcgcggatc
gtccgcgaagccggtttcaaggcgatctggggctcgggcctcgcgatctccgcgcaattc
ggcgtgcgcgacaacaatgaagcaagctggacccaggtggtcgacacgctcgaattcatg
gccgacgcgagcgacctgccgatcctgctcgacggcgataccggctacggcaacttcaac
aacgtgcgccgtctcgtgcgcaagctcgaacagcgcggcattgccggcgtgtgtatcgaa
gacaagcagtttcccaagaccaacagcttcatcaacggcgaagcgcaaccgctcgccgat
atggacgagttctgcggcaagatcaaggccggtaaagactcgcagtcggacgaaaacttt
tcgatcgtcgcgcgcgttgaagcgttgatcgccggctggggcatggacgaagcgctgcgt
cgcgcggaagcctaccgccaggccggcgcggatgcgatcctgattcacagcaagctctcg
cgtcccgacgaaattctcgagttcgcgcgcgaatgggcgggccgtggtccgctcgtgatc
gtgccgaccaagtactacagcacgcccaccgaagtgttccgcgaagccggcatcagcacg
gtgatctgggcgaaccatctgattcgcgcggccacttcggccatgcaggcggttgcgagg
gaaatccattcgagcgaaacgctcgtcaacgtggaagacagcattgccgccgtcaacgaa
atcttccgtctgcaggatgccgacgaatattcggaagccgaagaccgctatctgtcgagc
ggccgtgcggccggttccgcggtcgtgctcgcggcaagccgcggcaagggtctcgaagcc
gtcaccgaagaccgtccgaaagtgatgctgccgatcgccggcaaaccgctgctgcgctgg
ctcgtcgatgcgttcaagaagcagggcgtgaacgacatcaccgtggtcggcggttatcgc
gccgacgcgatcgacacggccggcatcaagctggtggtcaacgaacagcacgcgcaaacc
ggcgaactcgcgtcgctcgcctgcgcggtcgacaagctggcgggcgacacggtgatctcg
tacggcgatctgctgttccgcagctatatcctgcgcgatctcgtggagagcgaagcggcg
ttcagcgtggtggtcgattcgtcgctgaccgacgcggaaaacgccagcgtgcgcgatttc
gcgtggtgctcggcggccgacgaccgcggtctgttcggcaacaaggtcgtgctgcgtcac
gtatcgagcgggcaggacgccagctcggccatcgcgtcgcaaacgccgcatggccgctgg
gtcggtctgctgaacgtgcgtggcgaaggccgcgagcgtttgcaggcggtcatgagccag
ttgcaggcgcgcccggatttcgcgtcgctcgacatgcccgcgttgctgaacgcgctgatc
gaagcgggtgaatcgatcgaagtgcaatacgtgcacggccactggcgcggcgtgaacgac
ctcgaagatttccgccgtgcgggcgacttcgcgcatgcgcaagcgccgttcgcgaccgcg
gccggcggctcggcgaacagcgcatcggcggacgcggcgagcggagccgcgcaatga

DBGET integrated database retrieval system