KEGG   Paraburkholderia xenovorans LB400: DR64_4780Help
Entry
DR64_4780         CDS       T03290                                 

Gene name
cbxSC
Definition
(GenBank) ribulose bisphosphate carboxylase small chain, chromosomal
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00630  Glyoxylate and dicarboxylate metabolism
bxb01100  Metabolic pathways
bxb01120  Microbial metabolism in diverse environments
bxb01200  Carbon metabolism
Module
bxb_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DR64_4780 (cbxSC)
Enzymes [BR:bxb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     DR64_4780 (cbxSC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AIP37651
UniProt: Q13QV0
LinkDB All DBs
Position
2:complement(356135..356563)
Genome map
AA seq 142 aa AA seqDB search
MRITQGTFSFLPELTDEEIRLQIDYALSQGWACSVEYTDDPHPRNTYWEMWGLPMFDLRD
AAGVLQEVKACRAAQPQHYIKVNAFDSVRGFETMRLSFIVNRPDEEPGFRLTRQDGPGRV
QRYGLSGYAGDRPSGERYGPAR
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattacacagggcacgttttccttcctgccggaattgaccgacgaagagatccgt
ttgcagatcgactacgcgctgagccagggctgggcctgctcggtcgaatacaccgacgac
ccgcatccgcgcaacacgtattgggaaatgtggggcctgccgatgttcgatctgcgcgat
gcggccggcgtgctgcaggaagtgaaggcgtgccgcgcggcgcagccgcagcactacatc
aaggtcaatgcattcgactcggtgcgcggcttcgagacgatgcgcctgtcgttcatcgtc
aaccggccggacgaagagccgggcttccgcctgacgcgccaggacgggccgggacgcgtg
cagcgctacgggttgtcgggctacgcgggcgaccggccgtcgggcgaacgatacggaccc
gcgcgctag

DBGET integrated database retrieval system