KEGG   Paraburkholderia xenovorans LB400: DR64_494Help
Entry
DR64_494          CDS       T03290                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00020  Citrate cycle (TCA cycle)
bxb00310  Lysine degradation
bxb00380  Tryptophan metabolism
bxb01100  Metabolic pathways
bxb01110  Biosynthesis of secondary metabolites
bxb01120  Microbial metabolism in diverse environments
bxb01130  Biosynthesis of antibiotics
bxb01200  Carbon metabolism
Module
bxb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bxb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DR64_494 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    DR64_494 (sucA)
   00380 Tryptophan metabolism
    DR64_494 (sucA)
Enzymes [BR:bxb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     DR64_494 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AIP30394
UniProt: Q140T8
LinkDB All DBs
Position
1:complement(506510..509371)
Genome map
AA seq 953 aa AA seqDB search
MMKQFQSNSYLFGGNAPYVEEMYEAYLDNPASVPENWRSYFDALQNVPASDGSNANDVAH
GPIVESFAQRAKANAFIPRGAGGGEDLATARKQVYVQSLIGAYRFLGSQWANLDPLKRRE
RPAIPELEPAFYDFTEADMDQEFSATNLYFGFERASLREIVKALRDTYCGTIGAEYMYIS
DPEQKRWWKEKLESIRSTPNFSNEKKKHILNRLTAAEGLERFLHTKYVGQKRFSLEGGES
FIASMDEVVRHGGANGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAGD
VKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDDSGLQVLPVQI
HGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDSRSTLYCSDVVKM
IEAPVLHVNGDDPEAVVLATQLAIDFRMQFHKDVVVDIVCFRKLGHNEQDTPAVTQPLMY
KTIAKHPGTRALYAEKLVQQGVITAADADEYVKAYRKAMDEGHHTVDPVLSNYKSKYAVD
WVPFLNRKWTDAADTAVPLAELKRLAERITTIPENFKVHPLVERVINDRRAMGRGEAKLD
WGMGEHLAFASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAEG
QAKFTVIDSVLSEEAVLGFEYGYSTAEPNTFVAWEAQFGDFVNGAQVVIDQFISSGEVKW
GRVSGLTMLLPHGYEGQGPEHSSARIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIRL
FRKPLIVATPKSLLRHKEAVSDLSELAKGAFQPILGEIDEAIDAKKVKRVVVCSGRVYYD
LLAHRRESKSNDVAIIRIEQLYPFAHKQFEAEMKKYDNATEVVWVQDEPQNQGPWFYIEH
HLKDGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALVEGAFGRLKSASIAK
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaattccagtcgaactcttacctgttcggcggcaatgctccgtacgtagaa
gaaatgtacgaagcgtatctcgataatccggcgtcagtgcccgagaactggcgcagctat
ttcgacgcattgcagaacgtcccggcatcggatggcagcaatgccaacgacgtggcccac
ggcccgatcgtcgaatcgtttgctcaacgggccaaggctaatgccttcatcccgcgcgga
gcaggtggcggcgaagatctcgctaccgctcgcaagcaggtttatgtgcagtccctcatc
ggcgcatatcgcttcctcggctcgcaatgggccaatctcgatcccctgaagcgccgcgaa
cgtcccgccattcccgaactcgaacccgcgttctacgacttcaccgaagccgacatggac
caggagttcagcgccacgaatctgtatttcggattcgagcgcgcttcgctgcgcgagatc
gtcaaggcattgcgcgacacgtactgcggcacgatcggcgccgagtacatgtacatcagc
gatccggaacagaagcgctggtggaaagagaagctcgaatcgatccgttccacgccgaac
ttctcgaacgaaaagaaaaagcacatcctcaatcgcctgacggccgctgaaggcctcgag
cgcttcctgcacaccaagtacgtcggccagaaacgcttctcgctcgaaggcggcgaaagc
ttcatcgcgtcgatggacgaagtcgtgcgtcacggcggcgccaacggcgttcaggaaatc
gtcatcggcatggctcaccgtggccgtctgaacgtgctggtcaatacgctcggcaagatg
ccggccgacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggccggcgac
gtgaagtaccacaagggtttctcgtcggacgtctcgaccgaaggcggcccggttcacctg
tcgctcgcgttcaacccgtcgcacctcgaaatcgtcaacccggtggtcgaaggttcggcc
aaggcacgtatggaccgccgcggcgacgacagcggcctgcaagtgctgccggtgcagatc
cacggcgacgcggccttcgcgggccagggcgtggtgatggaaacgctgaacctcgcgcaa
acgcgcggttacggcacgcacggcacgctgcatatcgtcatcaacaaccagatcggcttc
acgacgtcggatccgcgcgactcgcgctccacgttgtattgctcggacgtcgtcaagatg
atcgaagcgccggtgctgcacgtgaacggcgacgatcctgaagcggtggtgctggctacg
cagctggcaatcgacttccgcatgcagttccacaaagacgtcgtcgtcgacatcgtctgc
ttccgcaagctgggtcacaacgagcaggacacgccggctgtcacgcagccgctgatgtac
aagaccattgcgaagcacccgggcacgcgcgcgctgtacgctgaaaagctggtgcagcaa
ggcgtgatcacggcggccgacgcagacgaatacgtcaaggcctaccgcaaggcgatggac
gaaggccatcacacggtcgacccggtgctctcgaactacaagagcaagtacgcggtggat
tgggtgccgttcctgaaccgcaagtggaccgacgctgccgataccgcagtgccgctcgcg
gaactgaagcgccttgctgaacgcatcaccacgattccggaaaacttcaaggttcacccc
ctggtcgagcgcgtcatcaacgaccgtcgcgcgatgggccgtggtgaagcgaagctcgac
tggggcatgggcgaacacctggcattcgcgtcgctggtcgcctcgggctatgcagttcgc
ctgaccggccaggactcgggccgcggcacgttcacgcaccgtcacgcggtgctgcacgat
cagaaccgcgaacgctggaacgacggcacgtacgtgccgctgcaaaacatcgccgaaggt
caggcgaagttcacggtgatcgactcggtgctgtcggaagaagcggtgctgggcttcgaa
tacggttattcgaccgctgagccgaatacgttcgttgcatgggaagcgcagttcggcgac
ttcgtgaacggcgcgcaagtcgtgatcgaccagttcatctcgtcgggcgaagtgaagtgg
ggccgtgtttcgggtctcaccatgctgctgccgcacggctacgaaggccagggtccggaa
cactcgtccgcacgtatcgagcgtttcctgcaactgtgcgcggatcacaacatgcaggtc
gttcaaccgaccacgccggcgcagattttccacctgctgcgccgtcagatgatccgcctg
ttccgcaagccgctgatcgtcgccacgccgaagtcgctgctgcgccacaaggaagccgtg
tcggatctgtcggaactggcgaagggcgcgttccagccgatcctcggcgaaatcgacgaa
gccatcgacgcgaagaaggtcaagcgcgtggtcgtgtgctcgggccgcgtgtactacgac
ctgctcgcacatcgccgtgaatcgaagtcgaacgacgtcgcgatcatccgtatcgaacag
ctctatccgttcgcgcacaagcagttcgaagcggaaatgaagaagtacgacaacgcgacc
gaagtggtctgggtgcaggacgagccgcagaatcagggcccgtggttctacatcgagcac
cacctgaaggacggcatgaaggaagggcagaagctggcatacagcggacgtccggcttcg
gcctcgccggcagtcggctattacgcgaagcactacgagcagcagaaggcgctggtcgaa
ggcgctttcggccgcctcaagagcgcgtcgatcgctaaataa

DBGET integrated database retrieval system