KEGG   Paraburkholderia xenovorans LB400: DR64_5614Help
Entry
DR64_5614         CDS       T03290                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DR64_5614
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bxb02000]
    DR64_5614
Enzymes [BR:bxb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DR64_5614
Transporters [BR:bxb02000]
 Other Transporters
  Pores ion channels [TC:1]
   DR64_5614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_N_4 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AIP36198
UniProt: Q13JR6
LinkDB All DBs
Position
2:complement(1321403..1322080)
Genome map
AA seq 225 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELGVPYEIKRYERDPKTMLAPPELRAVHPLGKSPVITDDG
QTIAESGAIIEYLIDRYGQGRFAPAPGTPERLRYTYWLHYAEGSAMPPLLLKLVALRIAS
APMPFFARPIARKIAATLQSSFIDPQLKLHLGYINQELSKTGWFVGNDFTAADVQMSFPL
EAATARGGMDGQIPAVVDFLKRIHARPAYQRALERGGKYELLGGD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgtccatcatctgaacaactcccgctcgcagcgtgtgctatggctgctcgaa
gaactcggcgttccgtacgagatcaagcgttacgagcgtgatccgaaaacgatgctggcg
ccgcccgagctgcgcgcggtgcatccgctcggcaagtctcccgtcattaccgacgatggc
cagacgatcgccgagtcgggcgcgatcatcgagtatctgatcgacaggtacgggcaggga
cgttttgcgccggcgcccggcacaccggagcggctgcgttacacctactggctgcactac
gcggaaggttcggcaatgccgccgctgctgctcaaactcgtggcgctgcgtattgccagc
gcgccgatgccgttcttcgccaggccgatagcgcgcaagatcgccgcgacgctgcaatcg
agttttatcgatccgcagttgaagctgcacctcggctacatcaatcaggaattgagcaag
accggctggtttgtcggcaacgacttcaccgcggcagacgtgcaaatgagttttccactc
gaagccgccacggcgcgcggcgggatggacgggcagattcctgcggtggtcgattttctc
aagcgcattcatgcgagacccgcttatcagcgggcgctggagcgcggcggcaaatacgaa
ctgctcggcggcgattga

DBGET integrated database retrieval system