KEGG   Paraburkholderia xenovorans LB400: DR64_8619
Entry
DR64_8619         CDS       T03290                                 

Gene name
bphD
Definition
(GenBank) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
  KO
K10222  2,6-dioxo-6-phenylhexa-3-enoate hydrolase [EC:3.7.1.8]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00621  Dioxin degradation
bxb01100  Metabolic pathways
bxb01120  Microbial metabolism in diverse environments
bxb01220  Degradation of aromatic compounds
Module
bxb_M00543  Biphenyl degradation, biphenyl => 2-oxopent-4-enoate + benzoate
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    DR64_8619 (bphD)
Enzymes [BR:bxb01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.8  2,6-dioxo-6-phenylhexa-3-enoate hydrolase
     DR64_8619 (bphD)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF1057 Esterase DUF915 Ndr AvrE_T3Es
Other DBs
NCBI-ProteinID: AIP34948
UniProt: P47229
LinkDB
Structure
PDB: 

Position
3:1296223..1297083
AA seq 286 aa
MTALTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFV
DAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNSMGGATALN
FALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQS
LITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFV
PLDHGLKLLWNIDDARLHVFSKCGHWAQWEHADEFNRLVIDFLRHA
NT seq 861 nt   +upstreamnt  +downstreamnt
atgaccgcactcaccgaaagttctaccagcaagttcgtgaaaataaatgaaaaaggtttt
tccgatttcaatattcactacaacgaggcgggtaacggcgaaaccgtcatcatgctgcat
ggcgggggccccggcgctggcggctggagtaactactaccgcaacgtcggaccgtttgtc
gacgccggttaccgggtgatcctgaaggattcgcccggcttcaacaagtcggacgcggtg
gtgatggacgagcagcgcggcctggtcaacgcccgtgccgtcaaagggctgatggatgcg
ctggacatcgaccgggcgcacctggtcggcaactcgatggggggcgccacggcgctgaac
ttcgcgctcgaataccccgaccgcatcggcaaactgatcctcatggggcccggcggcctg
ggccccagcatgttcgcgccgatgccgatggaaggcatcaagctgctgttcaagctgtat
gccgagccgtcctacgagacgctgaaacagatgcttcaggtgtttttgtacgaccagtcc
cttatcaccgaggagttgctgcagggccgctgggaagccattcagcgccaaccggaacac
ctgaagaacttcctcatcagcgcacaaaaggcgccgctttcaacctgggatgtgactgcc
agacttggagaaatcaaggccaagacattcattacctgggggcgcgatgatcgcttcgtt
ccccttgaccacggtttgaagctgctctggaacatcgacgacgcgcgtttgcacgttttc
tccaagtgcggccattgggcgcaatgggagcatgccgatgaattcaaccgcctggtgatt
gacttcctgcggcacgcgtaa

DBGET integrated database retrieval system