KEGG   Paraburkholderia xenovorans LB400: Bxe_A0354Help
Entry
Bxe_A0354         CDS       T00340                                 

Definition
(GenBank) Putative penicillin-binding 1 (peptoglycansynthetase) transmembrane protein, MrcA
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00550  Peptidoglycan biosynthesis
bxe01100  Metabolic pathways
bxe01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bxe_A0354
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Bxe_A0354
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bxe01003]
    Bxe_A0354
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bxe01011]
    Bxe_A0354
Enzymes [BR:bxe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Bxe_A0354
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Bxe_A0354
Glycosyltransferases [BR:bxe01003]
 Polysaccharide
  Bacterial polysaccharide
   Bxe_A0354
Peptidoglycan biosynthesis and degradation proteins [BR:bxe01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Bxe_A0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ABE32579
UniProt: Q13TL0
LinkDB All DBs
Position
1:4484508..4486907
Genome map
AA seq 799 aa AA seqDB search
MQSTSPTSPPPAPQKRKRPLWLKLIIGFVGLIVAGILCVLLVLGYALVVATPNLPSLDAL
TDYRPKVPLRIYTADHVLIGEFGEERRDIVHIQDVPDSLKKAILAIEDARFYDHGGVDLT
GIARAGIVALTNGHATQGASTITMQVARNFFLSSEKTYTRKIYEMLLAYKIESKLSKDQI
LEVYMNQIYLGQRAYGFASAARVYFGKDLKDLTLAESAMLAGLPKAPSAYNPVVNPKRAK
VRQEYILQRMYELHYITQEQYDEASKQPLVVKGAGKEFSVHAEYVAEMVRQMMYAQYREE
AYTRGLNVVTTIDSADQDVAYRALRKGLTDYERRHGYRGPEAFIDLPSDADDREQAIDDA
LLEHPDNGEIIAAVVTAASPKQVQAAFIDGNVATIQGDGLRFAQFALGPRAQPNQRVRPG
AIIRLVKNDDGDWSITQLPQVEGAFVSVIPQDGAIRALVGGFDFNKNKFNHVTQAWRQPG
SSFKPFIYSASLEKGLGPATVINDAPLFFSAAETGGQAWEPKNYGGGFDGPMTMRTALQR
SKNLVSIRILNQIGTKYAQQYITRFGFDADRHPAYLPMALGAGLVTPLQMAGAYSVFANG
GYRINPYLIAEVTDQRGIVVAHAQPLVAAQSAPHAIEPRNAYVMNSLLQSVAQRGTGAKT
NVLKRTDLAGKTGTTNDSRDAWFAGYQHTLTAIAWIGYDNPRSLGDKETGGGLSLPVWVE
YMGRALKGVPEYKMPMPDGLTELGSELYFDDFTPGHGFVATVGISQAALDAEASGASAAA
PEQVGEQEKQDIMNLFRGH
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccacgtctcctacgtccccgccgcccgcgccgcagaagcgcaaacgcccgttg
tggctgaagctcatcatcggcttcgtgggtctcatcgtcgcaggcattctgtgcgtgctg
ctggtgctcggttatgcgctcgtcgtcgccacgcccaatctgccgtcgctcgatgcattg
accgattaccggcccaaggtgccgctgcgcatctatacggccgaccacgtgctgatcggc
gagttcggcgaggaacggcgcgacatcgtccacattcaggacgtgcccgatagtctgaag
aaggccatcctcgccattgaagacgcgcgcttctacgaccacggcggcgtcgacctcacc
ggcattgcgcgcgcgggtatcgtcgcgctgaccaatggccacgccacgcagggcgcgagc
acgatcaccatgcaggtggcgcgcaacttcttcctctccagcgagaagacttacacgcgc
aagatctacgagatgctgctcgcctacaagatcgaatcgaagctgtcgaaagatcagatt
ctcgaggtgtacatgaatcagatctatctcggtcaacgcgcgtacggattcgcaagcgcg
gcgcgcgtttacttcggcaaagacctgaaggatctgacgctggccgagtccgccatgctg
gccggactgcccaaggcgccgtccgcctataacccggtggtcaacccgaagcgcgcaaag
gtgcgccaggagtacatcctgcagcgcatgtacgagttgcactacatcacccaggaacaa
tacgacgaagcgagcaagcagccgctggtggtcaagggcgcgggcaaggagttcagcgtg
cacgcggaatacgtcgcggaaatggtgcgtcagatgatgtacgcgcaatatcgcgaggaa
gcctatacgcgcggcctgaacgtggtgaccacgatcgattcggccgaccaggacgtcgct
taccgggcgctgcgcaaaggtctgacggactacgaacggcgccacggttatcgcggtccg
gaggcgttcatcgatttgccgtccgacgccgacgaccgcgaacaggccatcgacgacgcg
ctgctcgaacacccggacaacggcgaaatcattgccgccgtggtcaccgcggcgagtccg
aagcaggtgcaggccgctttcatcgacggcaatgtcgcgacgatccagggcgacggcttg
cgcttcgcgcagttcgcgctcggtccgcgcgctcagccgaatcaacgtgtgcggcccggc
gcgatcatccggctcgtcaagaacgacgacggcgactggtcgatcacgcaattgccgcaa
gtggaaggcgcgttcgtttcggtgattccgcaagatggcgcgatccgtgcgctggtcggc
ggtttcgacttcaacaagaacaagttcaatcacgtgactcaggcgtggcgtcagccgggt
tcgagcttcaagccgttcatctattcggcgtcgctcgaaaagggactcgggccggcaacc
gtcatcaacgacgcgccgctctttttcagcgcggctgaaaccggcggccaggcgtgggag
ccgaagaactatggcggcggcttcgacggcccgatgaccatgcgcacggcgttgcagcgc
tcaaaaaacctggtgtcgattcgcatcctgaaccagatcggcacgaagtacgcgcagcag
tacatcacgcgcttcggcttcgacgcggatcgtcacccggcttatctgccaatggcgctg
ggcgccggtctcgtcacaccgttgcagatggcgggcgcgtactcggtgttcgccaacggc
ggctatcggatcaacccgtatctgatcgccgaagttaccgaccagcgcggcatcgtggtt
gcgcacgcgcagccgctggtggcggcgcaaagcgcgccgcacgcaatcgaaccgcgtaat
gcgtacgtgatgaacagcctgctgcaaagcgtggcgcaacgcggcacgggcgccaagacc
aatgtcctcaagcgcaccgatctcgccggcaagacgggcacgaccaatgattcgcgcgac
gcgtggttcgccggttatcagcacacgctcacggccatcgcgtggatcggctacgacaat
ccgcgcagcctcggcgacaaggaaaccggcggcggtctgtcattgcccgtgtgggtcgaa
tacatggggcgcgcgctcaagggtgtgccggagtacaagatgccgatgcccgacggcctg
accgaactcggctcggagttgtacttcgacgacttcacgccggggcacggtttcgtcgcc
acggtcggcatcagtcaggcggcgctggatgccgaggcgagcggcgcgtcggcggccgcg
cccgagcaggtcggcgaacaggagaagcaggacatcatgaacctgttccgcggccactga

DBGET integrated database retrieval system