KEGG   Paraburkholderia xenovorans LB400: Bxe_A0474Help
Entry
Bxe_A0474         CDS       T00340                                 

Definition
(GenBank) Putative long-chain-fatty-acid-CoA-ligase, FadD
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00061  Fatty acid biosynthesis
bxe00071  Fatty acid degradation
bxe01100  Metabolic pathways
bxe01212  Fatty acid metabolism
bxe02024  Quorum sensing
Module
bxe_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Bxe_A0474
   00071 Fatty acid degradation
    Bxe_A0474
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bxe_A0474
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bxe01004]
    Bxe_A0474
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bxe04147]
    Bxe_A0474
Enzymes [BR:bxe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Bxe_A0474
Lipid biosynthesis proteins [BR:bxe01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Bxe_A0474
Exosome [BR:bxe04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Bxe_A0474
  Exosomal proteins of breast cancer cells
   Bxe_A0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ABE32459
UniProt: Q13TY0
LinkDB All DBs
Position
1:complement(4356269..4357942)
Genome map
AA seq 557 aa AA seqDB search
MDKIWLKSYPPGVPAEIDPSRYSSVGELLEEAFRDHRAKPAFVCMGKEISYGELDVLSRK
LAAWLQSKGLARGARIAIMMPNVLQYPVAIAAILRAGYVVVNVNPLYTPRELEHQLKDSG
AEAIILLENFAVTLQAIVRNTSVKHVVVAAMGDLMGLKGTLVNFVVRKVKKMVPAWSLPG
HVRFNTAIAQGGRQNFEPVQQGPNDVAFLQYTGGTTGVAKGATLLHRNLIANVLQSEVWL
DPVRANRTDIDQFITVVALPLYHVFALTVCGLLTIRTGGLGVLIPNPRDIPGMIKALEGY
AITTIPAVNTLYNAMLNSPDFHKLDFSKLIAANGGGMAVQEAVARRWYEQTHTPIIEGYG
LSETSPCVTCNPVTVTEYSGTIGLPLPSTEISIRDDEGNEVPLGQPGEICIRGPQVMAGY
WNRPDETAKVMTEDGFFKSGDVGLMNERGFVKIVDRKKDMILVSGFNVYPNEIEDVVAKL
PGVFEVAAVGVPDQHSGEAVKLFVVKKDQALTDADIFAYCKQQLTGYKRPKIVEFRTELP
KSNVGKILRRELRDGRA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaatctggctgaaatcttatccacccggcgttcccgcagagattgacccaagc
cgctactcgtcggtcggagaactgctcgaagaagcattccgcgaccaccgcgccaagccg
gcgttcgtctgcatgggcaaggaaatcagctacggcgagctcgacgtgctttcgcgcaaa
ctcgccgcatggcttcagtcgaagggcttggcccgcggcgcacgcattgcgatcatgatg
ccgaacgtgctgcaatatccggtggcgattgccgctatcctgcgcgcgggctacgtggtc
gtgaacgtgaacccgctttacaccccgcgtgagttggagcatcagctcaaggacagtggc
gccgaggcgatcattctgctcgagaacttcgccgtcacgctgcaggcgatcgtacgcaac
acctcggtcaagcatgttgtcgtggccgcgatgggcgatctgatggggctgaagggcacg
ctggtgaacttcgtcgtgcgcaaggtgaagaagatggtgccggcgtggagcctgccaggt
cacgtcaggttcaataccgcgatcgcgcaaggtggacgccagaatttcgagccggtccag
caaggtccgaacgatgtcgcgtttctccagtacacgggcggcacgacgggcgtggccaag
ggcgcgacgctgctgcatcggaacctgatcgccaacgtgctgcagtcggaagtctggctc
gatccggtgcgcgcgaatcgtactgatatcgatcagttcatcaccgtggttgcattgcct
ttgtatcacgtgtttgcgttgacggtctgcgggttgctgacaatccgtaccggcggcctt
ggcgtgctgattccgaatccgcgcgacattccgggcatgatcaaggcgctcgaagggtat
gcgatcacgaccattcccgccgtcaacacgctctacaacgcgatgttgaatagccccgat
ttccataagctcgatttttcgaagctgatcgctgcgaacggcggcggtatggcggtacag
gaggctgtggccaggcgctggtacgagcagacgcacacgccgatcattgaaggctacggc
ttgtcggaaacgtcgccgtgcgtgacctgcaatccggtgaccgtcaccgaatacagcggg
acgatcggtttgccgctgccgtcgacggaaatctcgattcgagacgacgaaggcaacgaa
gtgccactcggccagccgggcgaaatctgcatccgtggcccgcaggtcatggcaggttat
tggaaccggcccgacgaaacggcgaaagtgatgacggaggatggcttctttaaatcgggc
gatgtcggcctgatgaacgaacgcggcttcgtcaagatcgtcgaccgcaagaaggacatg
attctggtgtccggtttcaatgtctatccgaacgaaatcgaagacgtggtcgccaaactg
ccgggcgtgttcgaagtcgccgcggtcggcgtgcccgatcagcattcgggcgaggcggtg
aaactgttcgtcgtgaagaaggatcaggctcttaccgatgcggacatctttgcgtactgc
aagcagcaactgaccggttacaagcggccgaagatcgtcgaattccgcacggaactgccg
aagagcaacgtcggcaagatactgcgccgggagttgcgtgacgggcgggcgtag

DBGET integrated database retrieval system