KEGG   Paraburkholderia xenovorans LB400: Bxe_A1635Help
Entry
Bxe_A1635         CDS       T00340                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00061  Fatty acid biosynthesis
bxe00780  Biotin metabolism
bxe01100  Metabolic pathways
bxe01130  Biosynthesis of antibiotics
bxe01212  Fatty acid metabolism
Module
bxe_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Bxe_A1635
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Bxe_A1635
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Bxe_A1635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bxe01004]
    Bxe_A1635
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Bxe_A1635
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Bxe_A1635
Lipid biosynthesis proteins [BR:bxe01004]
 Fatty acid synthase
  Component type
   Bxe_A1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: ABE31320
UniProt: Q13X69
LinkDB All DBs
Position
1:3104964..3105755
Genome map
AA seq 263 aa AA seqDB search
MGFLAGKRILLTGLLSNRSIAYGIAQACRREGAELAFTYVGERFKDRIKEFAGEFGSDLV
FPCDVADDAQIDALFASLKQHWDGLDGLVHSIGFAPREAIAGDFLDGMTRENFRIAHDIS
AYSFPALAKAAQSMFTPDASLLTLSYLGAERAIPNYNTMGLAKASLEASVRYLAVSLGAK
GVRVNGISAGPIRTLAASGIKGFGKILEFVEQNAPLRRNVTIEQVGNTAAFLLSDLAAGV
TAEIVHVDSGFNAVVGGMAAVAE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcctcgctggcaaacgtatcctgctgaccggcttgttgtcgaaccgctcgatt
gcatacggtatcgcgcaagcctgcaggcgcgaaggcgccgagttggcgttcacctatgtc
ggcgagcgcttcaaggatcgcatcaaggagttcgccggcgaattcggcagcgacctggtg
ttcccctgcgacgtcgccgacgacgcgcagatcgacgccctcttcgcttcactgaagcaa
cactgggacggcctcgacggtctggtccattcgatcggctttgcgccgcgtgaagcgatt
gccggcgatttcctcgacggcatgacgcgcgaaaatttccgcatcgcgcatgacatctcc
gcgtacagcttccccgcgctcgccaaggccgcgcagtccatgttcacaccggacgcgtcg
ttgctcacgctgagctatctcggcgccgagcgcgcaattccaaactacaacacgatgggt
ctcgccaaggcttcgctcgaagcgagcgtgcggtatctggcggtctcgctcggcgccaaa
ggcgtgcgcgtcaacggcatttcggcgggcccgatcaggacgctggctgcgagcggtatc
aagggcttcggcaagattctcgagttcgtcgaacagaatgcgccgctcaggcgcaacgtg
acgatcgaacaggtcggcaacacggcggctttcctgctgtcggatctggcggccggcgtg
accgcggaaatcgtgcacgtcgatagcggcttcaatgcggtggtgggcggcatggctgct
gttgccgagtga

DBGET integrated database retrieval system