KEGG   Paraburkholderia xenovorans LB400: Bxe_A1660Help
Entry
Bxe_A1660         CDS       T00340                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00473  D-Alanine metabolism
bxe01100  Metabolic pathways
bxe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Bxe_A1660
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Bxe_A1660
Enzymes [BR:bxe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Bxe_A1660
Peptidoglycan biosynthesis and degradation proteins [BR:bxe01011]
 Precursor biosynthesis
  Racemase
   Bxe_A1660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABE31295
UniProt: Q13X94
LinkDB All DBs
Position
1:complement(3075365..3076435)
Genome map
AA seq 356 aa AA seqDB search
MPRPLSATIHTSALANNLAVARRYAPKSKIWAVVKANAYGHGLARVFPGLRATDGFGLLD
LEEAVKLRELGWAGPILLLEGFFRPTDIDVIDRYSLTTALHSDEQLRMLEMARLSKPVNI
QLKMNTGMNRLGYTPEKFRAAWERARAAQGVGQITLMTHFSDADGDRGVDYQVEAFERGA
QGIAGARSLANSAATLWHPATHFDWVRPGIILYGASPSGVTAAIEGTGLQPAMTFASELI
AVQTLHEGHTVGYGSSFKARGSMRIGVVACGYADGYPRVAPEGTPVIVEGVRTRIVGRVS
MDMLTVDLTPIPTANVGSRVELWGNALPIDDVAQACGTIGYELMCAVAPRVPMRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccccctttcagccacgatccacacctccgctctcgccaataatctcgccgtc
gcccggcgttacgcaccgaaatccaaaatctgggccgtcgtcaaggccaatgcttacggg
cacggtcttgcgcgcgtttttccgggcttgcgcgcaaccgacggcttcgggttgctggac
ctggaagaagccgtgaagttgcgtgaactgggctgggccgggccaattcttctgctcgaa
ggctttttccgcccgaccgatatcgacgtgatcgaccgctacagcctgaccaccgcgctg
cattcggacgagcaactgcgcatgctggaaatggcgcgcctgtccaaaccggtcaacatc
cagttgaagatgaacaccggcatgaaccgtctcggttacacgccggagaagttccgcgcc
gcgtgggagcgggcgcgcgctgcccagggcgtcggccagatcaccttgatgacccatttc
tcggacgccgacggcgaccgcggtgtcgactaccaggtggaggcattcgagcgcggcgcg
cagggcattgccggcgcgcgcagcctcgccaattcagcggccacgctgtggcatcctgcc
acgcacttcgactgggtgcgcccgggcatcatcctgtacggcgcgtcgccgtccggcgtg
acggccgcgatcgaaggcacgggtttgcagccggccatgacgttcgcctcggaactgatc
gccgtgcaaacgctccacgaaggccatacggtcggctacggttcgtcgttcaaggcgcgc
ggctcgatgcgcatcggcgtggtggcgtgcggctacgcggacggctatccgcgcgtcgcg
ccggaaggcacgccggtgatcgtcgagggcgtgcgcacgcggatcgtcgggcgcgtctca
atggacatgctcaccgtggacctgacgccgattcctaccgccaacgtcggctcgcgcgtc
gaactgtggggcaacgcgctgccgatcgacgacgtcgcgcaggcctgcggcaccatcggc
tatgagctgatgtgcgccgtggcgccgcgcgtgcctatgcgcgcggagtaa

DBGET integrated database retrieval system