KEGG   Paraburkholderia xenovorans LB400: Bxe_A2509Help
Entry
Bxe_A2509         CDS       T00340                                 

Definition
(GenBank) amino acid ABC transporter membrane protein, PAAT family
  KO
K10009  L-cystine transport system permease protein
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bxe_A2509
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bxe02000]
    Bxe_A2509
Transporters [BR:bxe02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    Bxe_A2509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABE30464
UniProt: Q13ZM5
LinkDB All DBs
Position
1:complement(2161351..2162010)
Genome map
AA seq 219 aa AA seqDB search
MSTTSLLVESLPVLAQGAVLTIKFAVLSMIFGLIAGAVLALMGVSHSRALNWIARIYVSV
MRGTPLLVQIFVIYYGLPSFGISLDPTPAGVIALSANVAAYLSESMRGAILGIHQGQWLA
AYSLGLSRRQTLRYVIAPQALRIAVPSLSNSLISLIKDTSLVSVITVTELLRSAQEIIAS
TYQPLPLYLAAAAVYWVLCQMLESVQRWYERRLALPSRH
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccacttccctgctcgttgaatcgctgcccgtgctcgcacagggcgccgtcctg
acgatcaagttcgcggttctgtcgatgatcttcggcctgatcgccggcgccgtgctcgcg
ttgatgggcgtgagccacagccgcgcgctgaactggatcgcacgcatttacgtgagcgtg
atgcgcggcacgccgctgctggtgcagatcttcgtgatctattacggcctgccgagcttc
ggcatttcactcgaccccacgccggccggcgtgattgcgttgtcggcgaacgtcgcggcg
tatctgtccgagagcatgcgcggcgcgattctggggattcaccagggtcagtggctcgcc
gcctatagtctcggcctctcgcgccgccagacgctgcgctatgtgatcgcaccgcaggcg
ttgcgcattgccgtgccgagtctgtcgaacagtctgatcagcctcatcaaggacacctcg
ctggtgtcggtgattaccgtgaccgaactgctgcgcagcgcgcaggaaatcatcgcctcg
acctatcagccgctgccgctctatctcgccgcggccgcggtctactgggtgctgtgccag
atgctcgaaagcgtgcagcgctggtacgaacggcgcctcgcgctgccgtcgcgccactga

DBGET integrated database retrieval system