KEGG   Paraburkholderia xenovorans LB400: Bxe_A2811Help
Entry
Bxe_A2811         CDS       T00340                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00020  Citrate cycle (TCA cycle)
bxe00310  Lysine degradation
bxe00380  Tryptophan metabolism
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
bxe01130  Biosynthesis of antibiotics
bxe01200  Carbon metabolism
Module
bxe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bxe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bxe_A2811
  09105 Amino acid metabolism
   00310 Lysine degradation
    Bxe_A2811
   00380 Tryptophan metabolism
    Bxe_A2811
Enzymes [BR:bxe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bxe_A2811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF4604
Motif
Other DBs
NCBI-ProteinID: ABE30152
UniProt: Q140T7
LinkDB All DBs
Position
1:1837830..1839113
Genome map
AA seq 427 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAQV
IANDGDTVTADQVIAKIDTEGTASAAAVEAEVKPAPQAAPAPAAAPAPAAQAASATGANT
AASPAAGKLMAEKGLGAGDVAGTGRDGRITKGDVLTAGAPAAKAAAPAPAAAPKAAKPSL
PDVKAPASAEQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLRN
KYKDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRG
LVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPII
NPPQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALEDP
ARLLLDL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctattgttgaagtcaaggtcccccagctttccgagtcggtttcggaagccaccatg
ctgcagtggaagaagaagcccggcgaggctgttgctcaagacgaaattctcatcgaaatc
gagaccgacaaggtcgtgctcgaagtgccggcaccctcggccggcgtgctcgcgcaagtc
atcgcgaacgacggcgacaccgtcacggctgatcaggtgatcgccaagatcgacaccgaa
ggcacggcaagcgccgctgctgtcgaagccgaagtcaagcccgctccgcaagccgcaccg
gcacccgccgctgcaccggctccggcggctcaagccgcatccgcaacgggtgcgaacacc
gctgcttcgccggccgccggcaagctgatggccgagaagggtctgggcgcgggcgacgtc
gccggcacgggccgcgacggccgcatcaccaagggcgacgtgctgaccgcgggcgcaccg
gctgcgaaggctgccgccccggctccggccgccgcaccgaaggcagcgaagccgtcgctg
ccggacgtcaaggcgccggcctcggctgagcaatggctgaaggaccgtccggaacaacgc
gtgccgatgtcgcgtctgcgtgcgcgtatcgccgaacgtctgctcgagtcgcagcaaacc
aacgccattctcaccacgttcaacgaagtgaacatggcgccggtcatggacctgcgcaac
aagtacaaagacaagttcgaaaaggaacatggcgtgaagctcggcttcatgtcgttcttc
gtgaaggcggcggtccacgcgctgaagaagttcccgctggtgaacgcgtcgatcgacggt
aacgatatcgtctatcacggctacttcgacatcggtatcgctgtcggttcgccgcgcggt
ctggtggtgccgatcctgcgcaacgcggatcagctgagcctcgctgaaatcgagaagaag
attgctgaattcggccagaaggcgaaagacggcaagctgtcgatcgaagaaatgaccggc
ggcacgttctcgatctcgaacggtggcgtgttcggttcgatgctgtcgaccccgatcatc
aacccgccgcaatccgcgattctgggcgtgcacgccacgaaggaacgcgccgtggtcgaa
aacggccagatcgtgatccgcccgatgaactatctggcgctgtcgtacgaccaccgcatc
atcgacggtcgcgaagcggtgctgtcgctggtcgccatgaaggatgcgctggaagatccg
gctcgcctgctgctcgacctgtaa

DBGET integrated database retrieval system