KEGG   Paraburkholderia xenovorans LB400: Bxe_A3526Help
Entry
Bxe_A3526         CDS       T00340                                 

Definition
(GenBank) Putative aldehyde dehydrogenase
  KO
K00130  betaine-aldehyde dehydrogenase [EC:1.2.1.8]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00260  Glycine, serine and threonine metabolism
bxe01100  Metabolic pathways
Module
bxe_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bxe_A3526
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.8  betaine-aldehyde dehydrogenase
     Bxe_A3526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF3819
Motif
Other DBs
NCBI-ProteinID: ABE29461
UniProt: Q143M8
LinkDB All DBs
Position
1:1038061..1039596
Genome map
AA seq 511 aa AA seqDB search
MLAEQPGNPSTAPAPLKHPDKLYIDGQWVAASTGKEFSVISPDTESVYVRVGEASEADIE
KAVSAARKAFDHGPWPRLSHAERGAYLRAMAEKLRARSHDMAAIWPHEMGVTYAFAQSFM
PRIAGIYDFYANLGDTFAFEERHATSSGIGNGLLVREPVGVVGAIIPWNAPAMIIAYKLA
PALIAGCTVILKSSPEAPGMALIIAEVAEEVGLPPGVVNVVTADRQASDALVRNAAVDKI
SFTGSSAVGKHIGSVLAQRVGRYTLELGGKSAAIVLDDYDLETAAKALATAASQMTCQVC
ASLTRIIVTKNRHDRLLEALASAYSSVKVGSPFDPATQMGPVATLRQRERVETYIAKGMQ
AGFTLAAGGKRPVHLPRGFYLEPTVFGNVSNRSELAQEEIFGPVLAVIPADSEEQAVEIA
NDSIYGLSGAVFTNDVDRAYSVARRVRTGSVAHNGFRNDFGIAFGGFKQSGIGREGGVEG
LMPYLETKTVLLEKLPSHHQTTQPRIVDSPA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgaacagccgggaaatccgtcgacagcgccggctccgctgaagcatcccgac
aaactgtatatcgacgggcagtgggtcgcagcctccaccggaaaggagttttcggtcatc
tcgccggatacggaaagcgtctatgtccgggtcggcgaggcaagcgaggccgatattgaa
aaggcagtttcggctgcccgcaaagcgttcgatcacgggccgtggcctcggctgagccat
gcggagcgaggcgcttatcttcgcgcgatggcggaaaaactgcgggcgcgctcgcacgac
atggccgcgatctggccgcacgagatgggcgtcacttacgcgttcgcgcagtcgttcatg
ccgcgcatcgcgggcatctacgacttctacgccaatctcggcgacacgttcgctttcgaa
gaacggcacgccaccagctcgggaatcggcaacgggctgctcgttcgcgagcccgtaggc
gtggtcggcgcgatcattccatggaatgcgcccgcgatgatcatcgcgtacaagctggcg
cccgcgttgatcgccggttgtaccgtgatcctcaagtcttcgccggaagcgccgggcatg
gcgctgataatcgcagaggtcgcggaggaagtcggtctgccgcccggagtcgtcaacgtg
gtcactgccgatcggcaagcgtcggacgcgctggtgcgaaacgctgcggtcgacaaaata
agctttaccggttcgagcgcggtcggcaagcatatcggcagcgtgcttgcgcagcgggtg
gggcgatataccctcgaactgggcggcaagtcggccgctatcgtactcgacgactacgac
ctggagacggcggcaaaagcgcttgcgacggcagcaagccagatgacctgccaggtttgt
gcgagcctgacccgcatcatcgtcaccaaaaaccgccacgaccgcctgctcgaagcgctc
gcctctgcgtattcctcggtgaaggttggcagtccgttcgatcccgccacgcaaatggga
cctgtggccacgctcaggcagagagagcgtgtcgagacctatatcgcgaaaggcatgcag
gccggtttcacgttagccgccggcggcaagcgtccggttcacctgccgcgtgggttctat
ctggagccgacggtgttcggcaacgtcagtaaccgttccgaactcgctcaggaggagata
ttcggtccggtgctcgccgtgattcccgccgacagcgaagagcaggcagtcgagatcgcg
aacgattccatctatgggttgagcggcgcggtgttcaccaacgacgttgatcgagcctat
tcggtcgcccgcagggtccgcaccggcagcgtggcccataacgggttccgcaacgacttc
ggcatcgctttcggcggcttcaaacagtccggcatcggtcgtgagggcggtgtcgaaggc
ttgatgccctatctcgagaccaagaccgtgctgctggaaaaactgccgtcgcatcatcaa
acaacgcaacctagaatagtggattcgccagcatga

DBGET integrated database retrieval system