KEGG   Paraburkholderia xenovorans LB400: Bxe_B0273Help
Entry
Bxe_B0273         CDS       T00340                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bxe_B0273
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bxe02000]
    Bxe_B0273
Enzymes [BR:bxe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bxe_B0273
Transporters [BR:bxe02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bxe_B0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_N_4 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ABE35673
UniProt: Q13JR6
LinkDB All DBs
Position
2:3073132..3073809
Genome map
AA seq 225 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELGVPYEIKRYERDPKTMLAPPELRAVHPLGKSPVITDDG
QTIAESGAIIEYLIDRYGQGRFAPAPGTPERLRYTYWLHYAEGSAMPPLLLKLVALRIAS
APMPFFARPIARKIAATLQSSFIDPQLKLHLGYINQELSKTGWFVGNDFTAADVQMSFPL
EAATARGGMDGQIPAVVDFLKRIHARPAYQRALERGGKYELLGGD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgtccatcatctgaacaactcccgctcgcagcgtgtgctatggctgctcgaa
gaactcggcgttccgtacgagatcaagcgttacgagcgtgatccgaaaacgatgctggcg
ccgcccgagctgcgcgcggtgcatccgctcggcaagtctcccgtcattaccgacgatggc
cagacgatcgccgagtcgggcgcgatcatcgagtatctgatcgacaggtacgggcaggga
cgttttgcgccggcgcccggcacaccggagcggctgcgttacacctactggctgcactac
gcggaaggttcggcaatgccgccgctgctgctcaaactcgtggcgctgcgtattgccagc
gcgccgatgccgttcttcgccaggccgatagcgcgcaagatcgccgcgacgctgcaatcg
agttttatcgatccgcagttgaagctgcacctcggctacatcaatcaggaattgagcaag
accggctggtttgtcggcaacgacttcaccgcggcagacgtgcaaatgagttttccactc
gaagccgccacggcgcgcggcgggatggacgggcagattcctgcggtggtcgattttctc
aagcgcattcatgcgagacccgcttatcagcgggcgctggagcgcggcggcaaatacgaa
ctgctcggcggcgattga

DBGET integrated database retrieval system