KEGG   Paraburkholderia xenovorans LB400: Bxe_B0305Help
Entry
Bxe_B0305         CDS       T00340                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD+)
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00010  Glycolysis / Gluconeogenesis
bxe00620  Pyruvate metabolism
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_B0305
   00620 Pyruvate metabolism
    Bxe_B0305
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Bxe_B0305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: ABE35641
UniProt: Q13JU8
LinkDB All DBs
Position
2:3034342..3035940
Genome map
AA seq 532 aa AA seqDB search
MRIRHVTSRQCRLSPSPPGQSLEASHMNHADMQFLDVEFPYARQYGNFIGGEWVPPVRGE
YFDNVSPITGEPFTSIPRSTEEDIELALDAAHRARKAWADTAPALRANVLNRIADRMEQN
LSRIAFSESIDNGKPIRETLAADIPLAIDHFRYFASCIRAQEGTLSEIDHDTVAYHFHEP
LGVVGQIIPWNFPILMAVWKLAPALAAGNCVVLKPAEQTPASILVLIELIQDLLPPGVLN
VVNGFGLEAGKPLASSKRIAKIAFTGETSTGRLIMQYASQNIIPVTLELGGKSPNIFFAD
VVDQDDGYFDKALEGFAMFALNQGEVCTCPSRVLIDEKIYDRFMERALKRVAAIAQGHPL
DPRTMIGAQASQEQLEKILSYVDLGKQEGAECLIGGERNTLGGELSKGYYVKPTVFRGNN
KMRIFQEEIFGPVVSVTTFRTEEEALEIANDSLYGLGAGVWTRDGTRAYRFGRQIQAGRV
WTNCYHAYPAHAAFGGYKQSGIGRETHKMMLDHYQQTKNLLVSYSEQPLGFF
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattcgtcacgtcacgtcacgtcaatgcaggctttctccgtcaccacccggacaa
tcattggaggcgtcacacatgaatcacgcggatatgcagtttctcgatgtcgaatttccg
tatgcgcggcaatacggcaatttcataggtggcgagtgggttcctccagtacgcggcgag
tacttcgacaatgtgtcgccgatcaccggcgaaccctttacgtcgattccccgttcaact
gaagaagatatcgaactcgctctggatgcggctcaccgcgcccgcaaagcctgggccgat
actgcacctgctctgcgcgcgaacgtgttgaaccgtattgcggaccgcatggagcagaac
ctctcgcgtatcgcgttttccgaatcgatcgacaacggcaagccgatccgcgaaacgctc
gccgccgacattccactcgcgatcgaccacttccgctacttcgccagttgcattcgcgca
caggaaggaacgctctccgagatcgatcacgacacagttgcctatcactttcacgaaccg
ctcggcgtagtcggccagatcattccgtggaatttcccgatcctgatggccgtgtggaag
ctcgcgcctgcactcgccgccggcaactgcgtggtgctcaagcctgccgagcaaacaccc
gcgtcgattctcgtgctgatcgaactgattcaggatttgctgccgccgggtgtgctgaat
gtggtcaatggtttcggtctcgaagccggcaaaccgctggcgtcgagcaagcgtatcgcc
aagatcgcgtttaccggcgagacttcgaccggccgcctgatcatgcagtacgcgagccag
aacatcattcccgtgacgctcgaactcggcggcaagagcccgaacattttcttcgccgat
gtggtcgatcaggacgatggctacttcgacaaggcactcgaaggcttcgcgatgtttgcg
ctgaatcagggcgaggtgtgtacctgtccgtcgcgtgtattgatcgatgaaaagatttac
gaccgcttcatggaacgcgcgttaaagcgcgtcgcggcgattgcgcaaggacatccgctc
gaccccaggacgatgatcggcgcgcaggcttcgcaggaacaactcgaaaagatcctctct
tatgtggatctcggcaaacaggaaggcgccgaatgcctgattggcggcgaacgcaatacg
ctgggcggtgagttgagcaaaggctattacgtgaagccgaccgtatttcgcggcaacaac
aagatgcgcatcttccaggaagagatcttcggaccggtggtgtcagtcacgacgttcagg
accgaagaagaggcactcgaaatcgccaacgattcgctctacggcctgggcgccggcgtg
tggacgcgcgacggtacacgcgcgtatcgcttcggcaggcagattcaggcaggccgcgtg
tggaccaattgctatcacgcctatccggcgcatgcggcgttcggcggctacaaacagtcg
ggcattggccgcgaaacgcacaagatgatgctcgaccattatcagcagaccaagaatctg
ctcgtgagctatagcgagcagccgctgggctttttctga

DBGET integrated database retrieval system