KEGG   Paraburkholderia xenovorans LB400: Bxe_B0834Help
Entry
Bxe_B0834         CDS       T00340                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00250  Alanine, aspartate and glutamate metabolism
bxe00280  Valine, leucine and isoleucine degradation
bxe00410  beta-Alanine metabolism
bxe00640  Propanoate metabolism
bxe00650  Butanoate metabolism
bxe01100  Metabolic pathways
bxe01120  Microbial metabolism in diverse environments
Module
bxe_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Bxe_B0834
   00650 Butanoate metabolism
    Bxe_B0834
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bxe_B0834
   00280 Valine, leucine and isoleucine degradation
    Bxe_B0834
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bxe_B0834
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bxe01007]
    Bxe_B0834
Enzymes [BR:bxe01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Bxe_B0834
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Bxe_B0834
Amino acid related enzymes [BR:bxe01007]
 Aminotransferase (transaminase)
  Class III
   Bxe_B0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABE35120
UniProt: Q13LB9
LinkDB All DBs
Position
2:2442363..2443652
Genome map
AA seq 429 aa AA seqDB search
MTMKNAELKSRKDAATPRGVGVMCDFYAERAENAELWDIEGRRFIDFAAGIAVCNTGHRH
PKIVAAIRDQLDHFTHTAYQIVPYASYVELAEKLNERAPGDYPKKTAFFTTGAEAVENAI
KIARAATGRPGVIAFTGAFHGRTLMGMALTGKVAPYKIGFGPFPSDVFHAPFPNPLHGVT
TADSLKAIEFLFKADIDPKRVAAIIFEPVQGEGGFYPAPAEFVRALRKLCNEHGILLIAD
EVQTGFARTGKLFAMNHYDVVPDLMTVAKSLAGGMPLSGVIGRADVMDAAAPGGLGGTYA
GNPLAVAAAHAVLDIIDEEKLCERATLLGDRIKAKLIALQSDVPQIADVRGPGGMVAVEF
CKAGTTEPDAEFTKRVQSRALERGLLLLVCGVYSNVVRFLFPLTIQEAVFDEALAILEDV
IKDSVAITV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaagaatgccgaactgaagagccgcaaagacgctgccacgccgcgcggcgtc
ggagtgatgtgcgatttctacgccgagcgcgctgaaaacgcggagctgtgggatatcgag
ggccgccgtttcatcgacttcgcggccggtattgcagtgtgcaacacgggccaccgtcat
ccgaagatcgtcgccgcgattcgcgaccagctcgatcacttcacccacacggcgtatcag
atcgtgccgtacgcgtcgtatgtcgagctggctgagaagctcaacgagcgcgcgccgggc
gactatccgaagaaaactgcgttcttcacgaccggcgccgaagccgtcgaaaacgcgatc
aagatcgcccgcgccgcgaccggccgccccggcgtgatcgccttcaccggcgctttccac
ggccgcacgctgatgggcatggcgctgaccggcaaggtcgcgccgtacaagatcggcttt
ggcccgttcccgtcggacgtgttccacgcgccgttccccaacccgctgcacggcgtgacc
accgccgattcgctgaaggccatcgaattcctgttcaaggccgacatcgatccgaaacgc
gtggccgcgatcattttcgaaccggtgcagggcgaaggcggtttctatccggcgccggcc
gaattcgtgcgcgccttgcgcaagctgtgcaatgagcacggcattctgctgatcgccgac
gaagtccagacgggtttcgcacgcaccggcaagctgttcgccatgaatcactacgacgtc
gtgcccgatctgatgacggtcgccaagagtctcgccggcggcatgccgctgtcgggcgtg
atcggccgcgcggatgtgatggacgcggccgcgcccggcggcctcggcggcacgtatgcg
ggcaatcctctggcggtggccgccgcgcatgcggtgctcgatatcatcgacgaagagaag
ctgtgcgaacgcgccacgctgctgggtgaccgcatcaaggccaaactgatcgcactgcaa
agcgacgtgccgcagatcgccgacgtgcgcggccccggcggcatggtcgcggtcgagttc
tgcaaggcaggcaccaccgagccggatgcggagttcaccaaacgcgtgcagagccgcgcg
ctcgaacgcggcttgctgctgctggtgtgcggcgtctattcgaacgtggtgcgcttcctg
ttcccgctcacgattcaggaggcggtcttcgacgaagcgctggcgattctcgaagacgtg
atcaaggacagcgtcgccatcacggtttga

DBGET integrated database retrieval system