KEGG   Paraburkholderia xenovorans LB400: Bxe_B2235Help
Entry
Bxe_B2235         CDS       T00340                                 

Definition
(GenBank) 2,3-dimethylmalate lyase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00440  Phosphonate and phosphinate metabolism
bxe01100  Metabolic pathways
bxe01120  Microbial metabolism in diverse environments
bxe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bxe_B2235
Enzymes [BR:bxe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Bxe_B2235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABE33751
UniProt: Q13Q88
LinkDB All DBs
Position
2:906743..908479
Genome map
AA seq 578 aa AA seqDB search
MNAREPAFISASRSARLRQMLVSNELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQF
GVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADMDEFCGKIKAGKDSQSDENFSIVARVEALIAGWGMDEALR
RAEAYRQAGADAILIHSKLSRPDEILEFAREWAGRGPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAREIHSSETLVNVEDSIAAVNEIFRLQDADEYSEAEDRYLSS
GRAAGSAVVLAASRGKGLEAVTEDRPKVMLPIAGKPLLRWLVDAFKKQGVNDITVVGGYR
ADAIDTAGIKLVVNEQHAQTGELASLACAVDKLAGDTVISYGDLLFRSYILRDLVESEAA
FSVVVDSSLTDAENASVRDFAWCSAADDRGLFGNKVVLRHVSSGQDASSAIASQTPHGRW
VGLLNVRGEGRERLQAVMSQLQARPDFASLDMPALLNALIEAGESIEVQYVHGHWRGVND
LEDFRRAGDFAHAQAPFATAAGGSANSASADAASGAAQ
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccgcgaacctgccttcatctccgcttcccgcagcgcgcgcctgcgccagatg
ctcgtcagcaacgaactcgaattcatgatggaggctcataacggcctgtccgcgcggatc
gtccgcgaagccggtttcaaggcgatctggggctcgggcctcgcgatctccgcgcaattc
ggcgtgcgcgacaacaatgaagcaagctggacccaggtggtcgacacgctcgaattcatg
gccgacgcgagcgacctgccgatcctgctcgacggcgataccggctacggcaacttcaac
aacgtgcgccgtctcgtgcgcaagctcgaacagcgcggcattgccggcgtgtgtatcgaa
gacaagcagtttcccaagaccaacagcttcatcaacggcgaagcgcaaccgctcgccgat
atggacgagttctgcggcaagatcaaggccggtaaagactcgcagtcggacgaaaacttt
tcgatcgtcgcgcgcgttgaagcgttgatcgccggctggggcatggacgaagcgctgcgt
cgcgcggaagcctaccgccaggccggcgcggatgcgatcctgattcacagcaagctctcg
cgtcccgacgaaattctcgagttcgcgcgcgaatgggcgggccgtggtccgctcgtgatc
gtgccgaccaagtactacagcacgcccaccgaagtgttccgcgaagccggcatcagcacg
gtgatctgggcgaaccatctgattcgcgcggccacttcggccatgcaggcggttgcgagg
gaaatccattcgagcgaaacgctcgtcaacgtggaagacagcattgccgccgtcaacgaa
atcttccgtctgcaggatgccgacgaatattcggaagccgaagaccgctatctgtcgagc
ggccgtgcggccggttccgcggtcgtgctcgcggcaagccgcggcaagggtctcgaagcc
gtcaccgaagaccgtccgaaagtgatgctgccgatcgccggcaaaccgctgctgcgctgg
ctcgtcgatgcgttcaagaagcagggcgtgaacgacatcaccgtggtcggcggttatcgc
gccgacgcgatcgacacggccggcatcaagctggtggtcaacgaacagcacgcgcaaacc
ggcgaactcgcgtcgctcgcctgcgcggtcgacaagctggcgggcgacacggtgatctcg
tacggcgatctgctgttccgcagctatatcctgcgcgatctcgtggagagcgaagcggcg
ttcagcgtggtggtcgattcgtcgctgaccgacgcggaaaacgccagcgtgcgcgatttc
gcgtggtgctcggcggccgacgaccgcggtctgttcggcaacaaggtcgtgctgcgtcac
gtatcgagcgggcaggacgccagctcggccatcgcgtcgcaaacgccgcatggccgctgg
gtcggtctgctgaacgtgcgtggcgaaggccgcgagcgtttgcaggcggtcatgagccag
ttgcaggcgcgcccggatttcgcgtcgctcgacatgcccgcgttgctgaacgcgctgatc
gaagcgggtgaatcgatcgaagtgcaatacgtgcacggccactggcgcggcgtgaacgac
ctcgaagatttccgccgtgcgggcgacttcgcgcatgcgcaagcgccgttcgcgaccgcg
gccggcggctcggcgaacagcgcatcggcggacgcggcgagcggagccgcgcaatga

DBGET integrated database retrieval system