KEGG   Paraburkholderia xenovorans LB400: Bxe_B2238Help
Entry
Bxe_B2238         CDS       T00340                                 

Definition
(GenBank) peptidoglycan synthetase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00550  Peptidoglycan biosynthesis
bxe01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bxe_B2238
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Bxe_B2238
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bxe01011]
    Bxe_B2238
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bxe03036]
    Bxe_B2238
Enzymes [BR:bxe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Bxe_B2238
Peptidoglycan biosynthesis and degradation proteins [BR:bxe01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Bxe_B2238
Chromosome and associated proteins [BR:bxe03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Bxe_B2238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ABE33748
UniProt: Q13Q91
LinkDB All DBs
Position
2:complement(902379..904112)
Genome map
AA seq 577 aa AA seqDB search
MIQKKKSQSHDPYAPVAKNRLLSARLPMWRSKFIVLLVFGAFASLAARAFWVQVVNQDFY
VDQGQKRYQRTIELDATRGRILDRNGSMLAVSLSTYEIWASPRLIDEAAFAPLSRLLDLP
LAELRRRLSGDKTFVLLKRQVDAETAGHLSRLGLAGITQIADSKRFYPEGESAAHVVGFT
DIEDNGQEGIELAANEQLLGVPGQREVIRDRLGRVVSETRPLVPAQNGETIHLTIDRRIQ
QLAYAQLKDAIARHHAEAGSVVVLDARNGEILALANYPSFDPNDRARLTGRQLRNRAVVD
TFEPGSTIKPVVVALSIDEGKVRPQSIIDTAPGWYKIGPAVIHDTSNHGAMTVAEAVQKS
SNIALAKLALNLPAEKIWTKYQEYGLGLRPELTFPGVASGKVRPYKRWRPIEQATMAYGY
GLSTSLLQIAQVYTAYAGDGTMHRVSLLRNGAGAAAQSADTGHAVTTPATARAIRAMLEM
ATGVGGTGRAATVEGYRIGGKTGTARKQVGATYAKNRYRALFVGMAPMSDPRLIVAVMID
DPAGKAFYGGTVAGPVFSGVTGGALQLLGVPPDAPAT
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgatccagaagaagaaatcgcaatctcacgacccctacgcgcccgtcgcgaagaaccgc
ttgctgagcgcgcgcctgccgatgtggcgatcgaaattcatcgtcctgctggtgttcggc
gcgttcgcctcgctggcggcccgcgcgttctgggtgcaggtggtgaaccaggatttctac
gtcgatcagggccagaaacgctatcaacgcactatcgaactcgacgcgacacgcgggcgg
atcctcgatcgcaatggctcgatgctcgccgtcagcctctcgacctacgagatctgggcc
tcgcccaggctgatcgacgaggccgcgttcgcaccgctttccaggctgctcgacctgccg
ctggcggaactgcgcaggcgtctgagcggcgacaagactttcgtcctgctcaagcgccag
gtggatgcggagaccgccgggcatctgtccagactgggcctggcgggcatcacgcagatc
gcggattcgaaacgcttttatcccgaaggcgaatccgcggcgcacgtggtcggcttcacg
gatatcgaggacaacggccaggaaggtatcgagctcgccgccaacgaacaactgctcggc
gtgcccggccagcgcgaagtgatccgcgaccgtctgggccgggtggtgtccgagacccgg
ccgctggtgcccgcgcagaacggcgaaaccatccacctgacgatcgaccggcggatccag
cagctcgcttacgcgcaactgaaggacgccattgcccgacatcacgctgaagccggcagc
gtggtggtgctcgatgcccgcaacggcgaaatcctggcgctcgccaactatcctagcttc
gatccgaacgaccgcgcccgcctgaccggccgccaactgcgcaatcgcgcggtggtggac
accttcgagccgggctcgaccatcaagccggtggtggtcgcactgtcgatcgacgagggc
aaggtgcggccgcagagcatcatcgacaccgcgcccggctggtacaagatcggcccggcc
gtgatccacgacacctcgaatcacggcgcgatgaccgtcgccgaagcggtgcagaagtcg
agcaatatcgcgctcgccaagcttgcgctgaatctgccggccgaaaagatctggaccaag
tatcaggaatacgggctcggcctgcgccccgagctgacctttccgggcgtggcgtcgggc
aaggtgcggccgtataaacgctggcgtccgatcgaacaggccacgatggcgtatggctat
gggctctccacgtcgctattgcagatcgcgcaggtctacacggcctatgccggcgacggc
acgatgcatcgcgtgagtctgttgcgcaatggggcgggcgccgccgcgcaatccgcggac
acgggtcatgcggtcacgacgccggccaccgcgcgcgccatccgcgcgatgctggaaatg
gcgaccggcgtgggcggcaccgggcgcgcggcgacggtggaaggctaccggatcggcggc
aagaccggcacggcgcgcaaacaggtcggcgccacttacgcgaagaaccgctaccgcgcg
ctgttcgtcggcatggcgccgatgagcgacccacgattgatcgtcgcggtgatgatcgac
gacccggcgggcaaggctttctacggcggcacggtggccggcccggtgttcagcggcgta
acgggcggcgcgctgcagttgctcggcgtgccgccggacgcgccggcgacctga

DBGET integrated database retrieval system