KEGG   Paraburkholderia xenovorans LB400: Bxe_B2452Help
Entry
Bxe_B2452         CDS       T00340                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00630  Glyoxylate and dicarboxylate metabolism
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
bxe01130  Biosynthesis of antibiotics
bxe01200  Carbon metabolism
Module
bxe_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bxe_B2452
Enzymes [BR:bxe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Bxe_B2452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABE33539
UniProt: Q13QV0
LinkDB All DBs
Position
2:675134..675562
Genome map
AA seq 142 aa AA seqDB search
MRITQGTFSFLPELTDEEIRLQIDYALSQGWACSVEYTDDPHPRNTYWEMWGLPMFDLRD
AAGVLQEVKACRAAQPQHYIKVNAFDSVRGFETMRLSFIVNRPDEEPGFRLTRQDGPGRV
QRYGLSGYAGDRPSGERYGPAR
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattacacagggcacgttttccttcctgccggaattgaccgacgaagagatccgt
ttgcagatcgactacgcgctgagccagggctgggcctgctcggtcgaatacaccgacgac
ccgcatccgcgcaacacgtattgggaaatgtggggcctgccgatgttcgatctgcgcgat
gcggccggcgtgctgcaggaagtgaaggcgtgccgcgcggcgcagccgcagcactacatc
aaggtcaatgcattcgactcggtgcgcggcttcgagacgatgcgcctgtcgttcatcgtc
aaccggccggacgaagagccgggcttccgcctgacgcgccaggacgggccgggacgcgtg
cagcgctacgggttgtcgggctacgcgggcgaccggccgtcgggcgaacgatacggaccc
gcgcgctag

DBGET integrated database retrieval system