KEGG   Paraburkholderia xenovorans LB400: Bxe_B2452Help
Entry
Bxe_B2452         CDS       T00340                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00630  Glyoxylate and dicarboxylate metabolism
bxe01100  Metabolic pathways
bxe01120  Microbial metabolism in diverse environments
bxe01200  Carbon metabolism
Module
bxe_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bxe_B2452
Enzymes [BR:bxe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Bxe_B2452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABE33539
UniProt: Q13QV0
LinkDB All DBs
Position
2:675134..675562
Genome map
AA seq 142 aa AA seqDB search
MRITQGTFSFLPELTDEEIRLQIDYALSQGWACSVEYTDDPHPRNTYWEMWGLPMFDLRD
AAGVLQEVKACRAAQPQHYIKVNAFDSVRGFETMRLSFIVNRPDEEPGFRLTRQDGPGRV
QRYGLSGYAGDRPSGERYGPAR
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattacacagggcacgttttccttcctgccggaattgaccgacgaagagatccgt
ttgcagatcgactacgcgctgagccagggctgggcctgctcggtcgaatacaccgacgac
ccgcatccgcgcaacacgtattgggaaatgtggggcctgccgatgttcgatctgcgcgat
gcggccggcgtgctgcaggaagtgaaggcgtgccgcgcggcgcagccgcagcactacatc
aaggtcaatgcattcgactcggtgcgcggcttcgagacgatgcgcctgtcgttcatcgtc
aaccggccggacgaagagccgggcttccgcctgacgcgccaggacgggccgggacgcgtg
cagcgctacgggttgtcgggctacgcgggcgaccggccgtcgggcgaacgatacggaccc
gcgcgctag

DBGET integrated database retrieval system