KEGG   Paraburkholderia xenovorans LB400: Bxe_B2453Help
Entry
Bxe_B2453         CDS       T00340                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00630  Glyoxylate and dicarboxylate metabolism
bxe01100  Metabolic pathways
bxe01120  Microbial metabolism in diverse environments
bxe01200  Carbon metabolism
Module
bxe_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bxe_B2453
Enzymes [BR:bxe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Bxe_B2453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABE33538
UniProt: Q13QV1
LinkDB All DBs
Position
2:673526..675025
Genome map
AA seq 499 aa AA seqDB search
MNDFSQPVIDSIHKPRDAANPRERYAAGVMKYREMGYWQPDYAPKDTDVIALFRITPQPG
VDPEEAAAAVAGESSTATWTVVWTDRLTACDIYRAKAYRVDPVPASNAAEPQYFAYIAYE
LDLFEEGSVANLTASIIGNVFGFKPLKALRLEDMRIPVAYLKTFQGPPTGIVVERERLDK
YGRPLLGATVKPKLGLSGKNYGRVVYEGLRGGLDFLKDDENINSQAFMHWRDRFLFAMEA
VNRAQAETGEVKGHYLNVTAGTMEDMYERAEFAKELGSCIVMIDLVIGWTAIQSMARWAR
RNDMILHLHRAGHSTYTRQRNHGISFRVIAKWLRMAGVDHAHAGTAVGKLEGDPLSVQGY
YNVCRESHNEVDLSRGIFFDQPWAGLRKVMPVASGGIHAGQMHQLLDLFGDDAILQFGGG
TIGHPAGIQAGAVANRVALEAMVKARNEGRDIVHEGPDILEAAARWCTPLKQALDTWRDV
TFNYASTDTPDFAATPTAA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatttcagtcaaccggtgatcgattccatacacaagccgcgcgacgcggcgaac
cctcgcgaacggtacgccgcgggcgtgatgaagtatcgcgagatgggctactggcagccc
gattacgcgccgaaagataccgacgtcatagcgctttttcgcatcacgccgcagcccggc
gtcgatccggaggaggcggcggcggccgtggccggcgaatcgtcgacggcaacctggacc
gtggtgtggaccgaccggctgaccgcgtgcgacatttaccgcgcaaaagcctatcgcgtt
gatccggtgccggcctcgaacgccgccgaaccgcagtatttcgcgtacatcgcctatgaa
ctggatctgttcgaagaaggctcggtcgccaacctgacggcgtcgatcatcggcaacgtg
ttcggcttcaaaccgctcaaggcgctgcgtctcgaagacatgcgcatacctgttgcttat
ctgaagacctttcaggggccgccgaccggaatcgtcgtcgagcgcgaacggctcgacaag
tacggacggccgctgctcggcgcgaccgtcaagcccaaactgggtttgtcgggcaagaac
tatggccgcgtcgtgtatgaaggattgcgcggcggtctggattttctgaaggacgacgag
aacatcaattcgcaggcgttcatgcactggcgcgaccgttttctgtttgcgatggaagcg
gtgaatcgcgcgcaggcggagacgggcgaggtcaagggccactacctgaacgtgacggcc
ggcacgatggaggacatgtatgagcgcgccgaattcgccaaggaactgggttcatgcatc
gtgatgatcgatctggtgatcggctggaccgcgattcagtcgatggcgcgctgggcgcgc
aggaacgacatgatcctgcacctgcatcgcgcggggcacagcacctatacgcggcagcgc
aaccacggcatttcgtttcgcgtgatcgcgaagtggctgcgcatggcgggcgtcgatcac
gcgcatgcgggcacggcggtcggcaagctcgaaggcgatccgctctcggtgcagggctat
tacaacgtgtgccgcgagtcgcacaacgaggtcgacctgtcgcgcggcattttcttcgac
cagccgtgggccggtctgcgcaaggtgatgccggtggcctcgggcggcattcacgcggga
cagatgcatcagctgctcgatctgttcggcgatgacgcgatcctgcagttcggcggcggc
acgatcggccatccggccggtattcaggcgggcgcggtggcgaatcgcgtcgcgctcgaa
gcgatggtgaaggcgcgcaacgagggccgcgacatcgttcacgaggggccggacattctc
gaagccgcggcgcgctggtgcacgccgctcaagcaggcgctcgatacgtggcgggacgtg
accttcaactacgcgtccaccgacacgccggatttcgccgccacgccgaccgcggcctga

DBGET integrated database retrieval system