KEGG   Paraburkholderia xenovorans LB400: Bxe_B2481Help
Entry
Bxe_B2481         CDS       T00340                                 

Definition
(GenBank) Ribonuclease BN
  KO
K07058  membrane protein
Organism
bxe  Paraburkholderia xenovorans LB400
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Bxe_B2481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ABE33510
UniProt: Q13QX9
LinkDB All DBs
Position
2:646607..647581
Genome map
AA seq 324 aa AA seqDB search
MQRTRRRLPHAVQMSRRTKVSRSIRPEAPARRRSGSIFHIAVEAVSRFASDRCTTLAASI
SFYAAFSLAPTLLIVLTVTGWFFGEAAARGKLFAQVHDILGNDAAGAMQAVVESAHRASG
GGLAALLSIVLLVIGASATFSSLNTALDVVFAAKPKAGLAGLALLVRARLISFGLVLGVG
FLLVVSLVLDTAITFVGQRLFGESPLVIAAQIAQTVFGIVVLSAAFTAMLRWLPDTHVPF
RHAMTGAIVSAVLFSVGRRLFGLYLAHAGTANSFGAAGSLAVLMLWLYFSAAVFLLGAEV
ASAMDGERQTPDGKKPVTVGQPRN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcacccggcggcgtttaccgcacgccgtgcaaatgtcgaggagaacgaaagtg
agccgatcgatccgcccggaagcgcccgcccgccgccgcagcggtagcatcttccacatt
gctgtcgaagccgtcagcagatttgcgtcggacagatgcacgactctggcggccagtatc
agcttctacgcggcgttttctctcgcgccgacgttgctgatcgtcctcacggtgacaggc
tggtttttcggcgaggccgccgcccgcggcaagctgtttgcgcaggtgcacgacatcctc
ggcaacgacgcagccggcgcgatgcaggccgttgtcgaaagcgcgcatcgtgcaagcgga
ggcggcctggccgcgcttctctcgatcgtgctgctggtgatcggcgcatcggccaccttc
agttcgctgaacacggcgctcgacgttgtcttcgccgcgaagccgaaagccgggctggcc
ggattggcccttctggtgcgagcacgcctcatttcgttcgggttggtactcggtgtcgga
ttcctgctcgtggtttcgctggtcctggatacggcaatcactttcgtcggacaacgactg
ttcggcgaatcgccgctggtgatcgccgcgcagatcgcgcaaaccgttttcggcatcgtc
gtgttatccgccgcttttacggcaatgctgcgctggttgccggacacgcatgtcccattt
cgccacgccatgacgggcgcaatcgtttctgcggttcttttctcggtgggacggcggctc
ttcgggctttacctcgcgcatgccggcacggcgaactcgttcggtgccgccggctcgctc
gccgtgctgatgttgtggctttatttctccgcagcggtgtttctactcggcgcagaggtc
gcttcagcgatggacggcgagcgtcagacgccggacggcaagaagcccgtaactgtcggg
cagccccgcaattga

DBGET integrated database retrieval system