KEGG   Paraburkholderia xenovorans LB400: Bxe_C1186
Entry
Bxe_C1186         CDS       T00340                                 

Gene name
bphD
Definition
(GenBank) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BphD)
  KO
K10222  2,6-dioxo-6-phenylhexa-3-enoate hydrolase [EC:3.7.1.8]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00621  Dioxin degradation
bxe01100  Metabolic pathways
bxe01120  Microbial metabolism in diverse environments
bxe01220  Degradation of aromatic compounds
Module
bxe_M00543  Biphenyl degradation, biphenyl => 2-oxopent-4-enoate + benzoate
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    Bxe_C1186 (bphD)
Enzymes [BR:bxe01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.8  2,6-dioxo-6-phenylhexa-3-enoate hydrolase
     Bxe_C1186 (bphD)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF1057 Esterase DUF915 Ndr AvrE_T3Es
Other DBs
NCBI-ProteinID: ABE37048
UniProt: P47229
LinkDB
Structure
PDB: 

Position
3:complement(1243994..1244854)
AA seq 286 aa
MTALTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFV
DAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNSMGGATALN
FALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQS
LITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFV
PLDHGLKLLWNIDDARLHVFSKCGHWAQWEHADEFNRLVIDFLRHA
NT seq 861 nt   +upstreamnt  +downstreamnt
atgaccgcactcaccgaaagttctaccagcaagttcgtgaaaataaatgaaaaaggtttt
tccgatttcaatattcactacaacgaggcgggtaacggcgaaaccgtcatcatgctgcat
ggcgggggccccggcgctggcggctggagtaactactaccgcaacgtcggaccgtttgtc
gacgccggttaccgggtgatcctgaaggattcgcccggcttcaacaagtcggacgcggtg
gtgatggacgagcagcgcggcctggtcaacgcccgtgccgtcaaagggctgatggatgcg
ctggacatcgaccgggcgcacctggtcggcaactcgatggggggcgccacggcgctgaac
ttcgcgctcgaataccccgaccgcatcggcaaactgatcctcatggggcccggcggcctg
ggccccagcatgttcgcgccgatgccgatggaaggcatcaagctgctgttcaagctgtat
gccgagccgtcctacgagacgctgaaacagatgcttcaggtgtttttgtacgaccagtcc
cttatcaccgaggagttgctgcagggccgctgggaagccattcagcgccaaccggaacac
ctgaagaacttcctcatcagcgcacaaaaggcgccgctttcaacctgggatgtgactgcc
agacttggagaaatcaaggccaagacattcattacctgggggcgcgatgatcgcttcgtt
ccccttgaccacggtttgaagctgctctggaacatcgacgacgcgcgtttgcacgttttc
tccaagtgcggccattgggcgcaatgggagcatgccgatgaattcaaccgcctggtgatt
gacttcctgcggcacgcgtaa

DBGET integrated database retrieval system