KEGG   Bacillus amyloliquefaciens XH7: BAXH7_00467Help
Entry
BAXH7_00467       CDS       T01836                                 

Gene name
alr
Definition
(GenBank) D-alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00473  D-Alanine metabolism
bxh01100  Metabolic pathways
bxh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bxh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BAXH7_00467 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BAXH7_00467 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bxh01011]
    BAXH7_00467 (alr)
Enzymes [BR:bxh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BAXH7_00467 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bxh01011]
 Precursor biosynthesis
  Racemase
   BAXH7_00467 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEK87613
LinkDB All DBs
Position
462483..463652
Genome map
AA seq 389 aa AA seqDB search
MNTASFYRDTWAEINLSAIKENITHMKKHIGENVHLMAVVKANAYGHGDLEVGKAALEAG
ASCLAVAILDEAISLRKRGITAPILVLGAVPPEYVQAAAEYDVTLTGYSVEWLQEAARHL
GSETVPFHLKVDTGMNRLGVKTEEEIQSVLKILSQNPGLVCKGVFTHFATADEKNRDYFL
FQFERFKKLIAPLPLKELMVHCANSAAGLRLKKGFFNAVRFGISMYGLRPSADIQNEIPF
QLKPAFTLHSVLSHVKKIRKGESVSYGATYTAEKDQWIGTVPIGYADGWLRKLSGTAVLI
DGKRMNIAGRICMDQLMVELDQSYPPGTKVTLIGSQKEETITMDEIAGRLETINYEIPCT
ISSRVPRMFLENESIMEVRNPLLQENTSK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacagcatccttttacagagatacgtgggcggaaatcaacctgtctgcgattaaa
gaaaatattacacatatgaaaaaacacatcggcgaaaacgtccatctcatggcggttgta
aaggcgaacgcgtatggccacggagatttggaagtcgggaaagccgcgcttgaagcgggt
gcctcttgtcttgccgttgccatactggatgaagcgatctcattgagaaaacgtggcatt
acagcgccgattctcgtgcttggcgccgtgccgcccgaatatgtacaagcagctgccgaa
tatgacgtaacactgacggggtattctgttgaatggcttcaggaagctgcacgccacctc
ggaagtgaaacagtgccgtttcacctgaaagtcgataccggcatgaacagactcggggtc
aaaacggaggaagaaatccaaagcgtattaaaaatcctcagccaaaacccgggtttagtc
tgtaaaggcgtttttacccattttgctaccgcggatgaaaaaaacagggattatttcctt
ttccaatttgagcgctttaaaaaattgattgctccgcttccgttaaaggaattgatggtg
cattgcgcgaacagcgctgccggccttcgtcttaaaaaaggcttctttaacgcggttcgt
ttcggcatcagtatgtacgggcttcgtccttctgccgacattcaaaatgaaattccattt
caattaaagccggcttttacgctgcactctgttttatcccatgtgaaaaagatccgcaaa
ggggaaagcgtcagctacggcgcaacatatacggcagagaaggatcaatggatcgggacc
gttcccatcggctatgcagacggctggctccgcaagctgagcggtacggccgtgctgatc
gacggcaaacggatgaatattgctggaagaatctgcatggaccaattgatggtagaactg
gaccaatcttatccgccgggcaccaaagtcaccctgatcggcagccagaaggaagaaacg
atcacgatggacgaaatcgccgggcggcttgagacgattaattacgagatcccttgtacg
attagttcccgcgttccccgtatgtttttggaaaatgagagtataatggaagtaagaaat
cctttactgcaagaaaatacaagtaagtaa

DBGET integrated database retrieval system