KEGG   Bacillus amyloliquefaciens XH7: BAXH7_00600Help
Entry
BAXH7_00600       CDS       T01836                                 

Gene name
ydjI
Definition
(GenBank) putative phage protein
Organism
bxh  Bacillus amyloliquefaciens XH7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Band_7_1 zf-ribbon_3 zinc_ribbon_2 DZR Band_7 zinc_ribbon_15 zf-NADH-PPase Nudix_N_2 zinc-ribbons_6
Motif
Other DBs
NCBI-ProteinID: AEK87745
LinkDB All DBs
Position
582508..583512
Genome map
AA seq 334 aa AA seqDB search
MGFFRNQLANVVEWEEFRDDMVFYKWNNREIKKGSRLIIRPGQDAIFLHNGKIEGIFRDD
GDYDIESEIIPFLSTLKGFKFGFNSGMRAEVLFVNTKEFTVKWGTKNAINIPAAGMPGGM
PIRANGTFNFKVIDYIGLIDKIAGVKDSYLVEDIKIRITSILDQLLMKWITREGKDMFNL
QSNSFEIGKGIQEDLDMQLIGDGMSITGFNIMSFNYPQEVQDMITKNASYGMVGDVNRYQ
QISMTDGMSSGKMSGSGTASDMAGMMMGMNMANQMMNQMNQNQQNQPQQSQNQQNQGTAP
ANGSEGAAKPKFCPNCGTKTEGANFCPNCGQKLA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgggttttttcagaaatcagttagcgaatgtggtggaatgggaagaattcagagacgac
atggttttctataaatggaacaaccgtgaaattaaaaaaggcagccgtctgatcatccgg
ccgggacaggatgccatctttttacacaacgggaagattgaagggatcttccgtgatgac
ggcgattatgatatcgagtcagaaatcattccgtttctatcgacgttaaaagggtttaag
tttggctttaacagcggcatgcgggcggaagtgctgtttgtgaatacgaaggagttcacc
gtgaagtggggcacaaaaaacgccatcaacattccggcggcgggaatgccgggcggtatg
ccgatccgcgcaaacggtacatttaacttcaaggtcattgactacatcggattgattgat
aagattgcgggtgtcaaagacagctatttagtagaggacattaaaatccggattacgtct
attctcgatcagcttttgatgaaatggatcaccagagaaggaaaagacatgttcaatctg
cagtcgaattcatttgaaatcggaaaagggattcaagaagatcttgatatgcagctgatc
ggagacgggatgtcgattacgggcttcaatatcatgagctttaactatccgcaggaagtt
caggatatgattacgaagaacgcttcttacggcatggtgggcgatgtgaatcgctatcag
cagatttccatgacggacggaatgtcatccggcaaaatgagcggaagcggcacagcctcc
gatatggccggcatgatgatgggaatgaatatggcaaatcaaatgatgaaccaaatgaat
caaaatcagcagaaccagccgcagcaaagtcaaaatcagcagaatcaggggacggcaccg
gcaaatggctcagaaggagcggctaagccgaaattctgtccgaactgcggaacgaaaacg
gaaggcgcgaatttttgcccgaattgcggacagaagcttgcctga

DBGET integrated database retrieval system