KEGG   Bacillus amyloliquefaciens XH7: BAXH7_00877Help
Entry
BAXH7_00877       CDS       T01836                                 

Gene name
yhbJ
Definition
(GenBank) putative integral inner membrane protein; putative exporter subunit
Organism
bxh  Bacillus amyloliquefaciens XH7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 Biotin_lipoyl HlyD HlyD_2 QRPTase_N Peptidase_M23 DUF3221
Motif
Other DBs
NCBI-ProteinID: AEK88019
LinkDB All DBs
Position
863791..864456
Genome map
AA seq 221 aa AA seqDB search
MIEEETKGENKMNRGRLILTNIIGLIVVLAIIGGGAYYYYQSTHYVKTDEAKVAGDMAAI
TAPAAGKVTDWNLDEGKEVSKNDVVAKIKGQQNADVKAIMDGTIVKNQVKNGQMVQAGTT
IAQEIDMKHLYITANIKETDIKDIEVGNKVDVVVDGDPNTTFDGTVEEIGYATTSTFDML
PSSNSSGNYTKVTQKVPVKISLSNPSDKVLPGMNASVKISE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatagaggaagaaacgaaaggagaaaacaaaatgaacagaggacgtttaattctgacc
aacattatcggtttgattgttgttcttgcaattataggcggaggtgcttactactattat
caaagcacacactatgtaaaaaccgatgaagcgaaagttgccggcgacatggctgctatc
acagctcctgctgcgggtaaagtaactgactggaaccttgacgaggggaaagaagtaagt
aaaaacgacgttgttgcaaaaatcaaaggacagcaaaatgctgacgtaaaagccatcatg
gatggaacaatcgtgaaaaaccaagtgaaaaacggccaaatggtgcaagccggtacgaca
attgcccaggaaattgacatgaaacacctttacatcactgcgaacattaaagaaacagac
attaaagacattgaagtaggaaacaaagtagatgtcgttgttgacggagacccgaataca
acatttgacggaactgtagaagaaatcggttatgcgacaacttcaacttttgatatgctg
ccttcttcaaactcaagcggcaactacacaaaagtaacgcaaaaagttcctgttaaaatt
tcacttagcaacccatctgacaaggtgcttcctggtatgaacgcatctgtaaaaatctct
gaataa

DBGET integrated database retrieval system