KEGG   Bacillus amyloliquefaciens XH7: BAXH7_00881Help
Entry
BAXH7_00881       CDS       T01836                                 

Gene name
yhcE
Definition
(GenBank) putative integral inner membrane hypothetical protein
Organism
bxh  Bacillus amyloliquefaciens XH7
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEK88023
LinkDB All DBs
Position
867153..867920
Genome map
AA seq 255 aa AA seqDB search
MTSFLGLLKKDAKVSWVWLAVWLCVMICWALTAHIIAARQKEPLVIFGFFAAMGFFQFLV
APLFMYYHLHKEGKNQLWLYNPNGGFYLLASKLTASLLYQFIGQLALTGYGIWMYRMLSA
KGALEQPVPLAGTMTGLNAYLLISSAYLSVIVAVFWTVFHSLKHFPILRWVICIVLAAVW
SYIDDKIMTPFTSSQHHLWPVKVYADFDFHYTKLAGWKMELTAVHFSLFSFLAVIVFSAV
CLALASMLLNRKVEV
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgtttttaggtttgctgaaaaaagatgcgaaggtttcatgggtctggctcgca
gtttggctttgcgtcatgatttgctgggcgcttacagcccacataatcgctgcccggcag
aaagaaccgctcgtcattttcggcttttttgcggcaatggggttttttcaatttcttgtg
gcgccgctttttatgtactatcacctccataaggaagggaaaaatcagctgtggctttac
aatccgaatggcgggttttatctgctggcttcgaagctgacggcctcactgctgtatcag
tttatcggacagctggcgctgaccggctacggcatttggatgtaccggatgctttctgca
aaaggagcccttgaacagcccgttccccttgccggcacaatgaccggactgaatgcttat
ctgctgatcagttcagcgtacttatctgtgatcgtagccgtattttggactgtttttcac
tcgttaaaacattttcccatcctccgttgggtgatctgcatcgtgcttgccgcagtatgg
tcttatattgacgataaaatcatgacgcctttcacttcatctcagcatcatttatggccg
gtaaaagtgtatgcggattttgattttcactatacaaaattggccggctggaagatggaa
ctgacggccgtccacttctcgcttttcagcttccttgccgtgatcgtgttttcggcggtt
tgtctcgcgctggcctctatgctgctgaatcgcaaggttgaggtgtaa

DBGET integrated database retrieval system