KEGG   Bacillus amyloliquefaciens XH7: BAXH7_00906Help
Entry
BAXH7_00906       CDS       T01836                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00564  Glycerophospholipid metabolism
bxh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bxh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAXH7_00906 (glpD)
Enzymes [BR:bxh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BAXH7_00906 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 GIDA FAD_oxidored NAD_binding_8 Cation_ATPase_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AEK88048
LinkDB All DBs
Position
890675..892342
Genome map
AA seq 555 aa AA seqDB search
MMNHQFSSLERDHMLEDMTKKTYDLFIIGGGITGAGTALDAASRGMKVALSEMQDFAAGT
SSRSTKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHKGGTFGSFS
TSIGLRVYDYLAGVKKAERRSMLSAKETLQKEPLVKKDGLKGGGYYVEYRTDDARLTIEV
MKEAVKFGAEPVNYSKVKELLYEKGKVVGVLVEDLLSGKEYKIYAKKIVNATGPWVDQLR
EKDHSKNGKHLQHTKGVHLVFDQSVFPLKQAVYFDTPDGRMVFAIPREGKTYVGTTDTVY
KQKLEHPRMTVQDRDYVVSSINYMFPELNITADDIESSWAGLRPLIHEEGKDPSEISRKD
EIWTSQSGLITIAGGKLTGYRKMAEHIVDLVRDRLKEEGGQDFGGCKTKTMPISGGHVGG
SKNFESFVEAKTKDGLKIGLSQETAKQLAIRYGSNVDNVFNRIEGLKDEAAKRQIPVHIL
AEAAYSIEEEMAATPADFFVRRTGRLFFDIKWVKTYKTAVIDYMSDRFQWDDETKAKHTE
WLNTLLHDAVVPLEQ
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatcaccaattttcaagtttggaacgggatcatatgctggaagacatgactaaa
aaaacatacgatctgtttattataggcggaggtattacaggtgccggtacggcgcttgac
gctgcttcaagaggaatgaaagtcgctttgagcgaaatgcaggattttgcggctggcaca
tcaagccgatctacaaagcttgtccacggcggcttgcgttatctgaaacaatttgaagtc
aaaatggtcgctgaagtcggtaaggaacgtgccattgtatatgaaaacggcccgcacgtg
acgacgccggaatggatgctgcttccgttccataaaggaggcacattcggttcattctct
acttccatcggtctgcgtgtgtatgactatttagcaggggtgaaaaaagcagagcgcaga
agcatgctgtctgcaaaagaaacactgcagaaagagccgcttgtcaaaaaagacggctta
aaaggcggaggctactatgtagagtaccggacggacgatgcgagactgacgattgaagtc
atgaaagaagccgttaaattcggtgcagagcctgtcaactattctaaagtgaaagagttg
ctgtatgaaaaaggaaaagttgtcggcgttttagttgaagatttgctgtcaggcaaggaa
tacaaaatttatgccaaaaaaatcgtcaatgcgacaggtccgtgggttgaccagctgaga
gaaaaagaccacagcaaaaacggtaagcatctccagcatacaaaaggggtccatcttgta
ttcgaccaatccgtattcccgcttaagcaggcagtgtactttgacacgccggacggccgg
atggtgttcgccattccgcgtgaaggaaaaacatatgtaggtacgacagatacggtttac
aaacaaaaacttgagcatccgcgcatgactgtgcaggatcgtgattatgtcgtcagctct
atcaattatatgttcccggaactgaatattacggctgacgatattgaatcaagctgggcc
ggcctcagaccgctcattcacgaagaaggaaaagatccgtctgagatctcccgtaaagat
gaaatctggacatctcaatccggcctgattacaatcgccggaggaaaactgacgggttat
agaaaaatggctgagcacattgtcgatcttgtccgcgaccgtttaaaagaagaaggcggc
caggacttcggcggctgtaaaacgaagacgatgccgatttccggaggacatgtcggcggc
tctaaaaacttcgagtcatttgtggaagcaaagacaaaagacggcttgaaaatcggttta
tcacaggaaactgctaagcagttagccatcagatacggctctaacgttgataatgtcttc
aaccgcattgaaggtctgaaagacgaagcggcaaaacgccagatcccggttcacattttg
gcggaagcggcttacagcattgaagaagagatggctgcgacacctgctgatttcttcgtc
cgcagaacgggcagactgttcttcgacatcaaatgggtgaaaacgtataaaacggctgtg
attgattacatgagcgaccgattccaatgggatgatgaaacgaaagcgaaacacaccgag
tggttaaacacgctgctgcatgatgcggttgttccgctcgaacaataa

DBGET integrated database retrieval system