KEGG   Bacillus amyloliquefaciens XH7: BAXH7_02622Help
Entry
BAXH7_02622       CDS       T01836                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bxh  Bacillus amyloliquefaciens XH7
Brite
Enzymes [BR:bxh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BAXH7_02622 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEK89748
LinkDB All DBs
Position
complement(2451430..2452035)
Genome map
AA seq 201 aa AA seqDB search
MAYKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGSALAEKSVDELVADL
NAVPEDIRTAVRNNGGGHANHSLFWTLLSPNGGGEPTGELAEEIKSTFGSFDQFKEKFAA
AAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPDY
ISAFWNVVNWDEVARLYSEAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaaacttccagaattgccttacgcttatgatgctttagaaccgcatatcgat
aaggaaacgatgacgattcaccatacgaagcaccataacacatacgttacaaacctgaac
aaagcgatcgaaggatcagcgcttgcagagaaatccgtagatgagcttgttgctgattta
aacgcagtgccggaggatatccgcacggctgtccgcaacaatggcggcggacatgcgaac
cactctttattctggactcttttatctccgaacggcggaggcgaaccgactggtgagctt
gctgaagagatcaaaagcacattcggaagcttcgatcaatttaaagaaaaattcgctgca
gcagctgccggccgtttcggttctggctgggcttggcttgttgtaaacaacggcaaactt
gaaattacaagcacgccaaaccaagattcaccgctttcagaaggcaaaacgcctatcctc
ggtcttgacgtttgggagcacgcttactacctgaactaccaaaaccgccgtcctgattac
atttcagctttctggaatgttgtgaattgggatgaagttgcccgtctttacagcgaagca
aaataa

DBGET integrated database retrieval system