KEGG   Bacillus amyloliquefaciens XH7: BAXH7_02774Help
Entry
BAXH7_02774       CDS       T01836                                 

Gene name
yrvI
Definition
(GenBank) D-tyrosyl-tRNA(Tyr) deacylase
  KO
K07560  D-aminoacyl-tRNA deacylase [EC:3.1.1.96]
Organism
bxh  Bacillus amyloliquefaciens XH7
Brite
KEGG Orthology (KO) [BR:bxh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bxh03016]
    BAXH7_02774 (yrvI)
Enzymes [BR:bxh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.96  D-aminoacyl-tRNA deacylase
     BAXH7_02774 (yrvI)
Transfer RNA biogenesis [BR:bxh03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    BAXH7_02774 (yrvI)
 Prokaryotic Type
    BAXH7_02774 (yrvI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tyr_Deacylase
Motif
Other DBs
NCBI-ProteinID: AEK89900
LinkDB All DBs
Position
complement(2583973..2584416)
Genome map
AA seq 147 aa AA seqDB search
MKLVVQRVTDASVTVDGAVAGRIGPGIMALVGVTHEDTEEDAAYLADKIVNLRIFDDESG
KMNLSLLDTGGEILSVSQFTLYGETKKGRRPNFMNAAKPDQALLLYEKWNELLREKGVKV
ETGIFGAMMDVQLTNSGPVTLIMDSKQ
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagttgttcagcgtgtaacagatgcaagtgtgacagttgacggcgctgtcgcc
ggccggatcggacccggcattatggcgcttgtcggcgtcactcatgaagatacagaggaa
gatgccgcctacttggccgataaaatcgtgaatctccggatttttgatgacgagagcggc
aagatgaatttatcgcttttggatacgggcggagagattttatcagtttcccagtttacg
ctttacggcgaaacgaagaaagggagacgcccgaattttatgaatgcggcgaaaccggat
caggctctgctcctttatgaaaagtggaacgaacttcttcgggaaaaaggagtcaaagtg
gaaaccggaatattcggggccatgatggatgttcagctgacaaattccgggcccgttaca
ttgattatggattctaaacaataa

DBGET integrated database retrieval system