KEGG   Bacillus amyloliquefaciens XH7: BAXH7_03407Help
Entry
BAXH7_03407       CDS       T01836                                 

Gene name
yusZ
Definition
(GenBank) short chain dehydrogenase
Organism
bxh  Bacillus amyloliquefaciens XH7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 DUF1776 Epimerase
Motif
Other DBs
NCBI-ProteinID: AEK90521
LinkDB All DBs
Position
3163596..3164438
Genome map
AA seq 280 aa AA seqDB search
MNRKIAVVTGATSGFGLLTALKLARSYHVIATARQPEKADALKEAAAQAGASAHITIVAL
DVTDEQSVSDFGKTVSGFGPVDLLVNNAGTAYGGFIEDVPMEHYRQQFETNVFGLIHVTK
TVLPSIRKNGGAKIINISSISGLTGFPALSPYASSKFAIEGFTECLRLELLPLGIDAALI
EPGSYKTSIWETSLSNQITAPGQDSPYYRFFQPIEANVKANASKSGDPDEVAELIYQLAQ
KKRLKKLRYPIGRGIKLTLAFRSLFPWSAWESVIKKKLFT
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaaaaattgccgttgtaaccggcgcgacgagcggattcgggctgctgacagcg
ctgaagcttgcccggtcttatcacgtcattgcaacagccagacagccggagaaagctgat
gcactgaaagaagccgccgctcaagcgggtgcatccgcccatattacgatcgttgcttta
gatgtgacggatgagcaatcagtgtctgacttcggtaaaaccgtcagcggtttcgggccg
gttgacctgctcgtgaacaacgccggcactgcgtacgggggatttattgaagatgtgccg
atggaacattacagacagcagtttgaaacgaatgtattcggcctgattcatgtcacaaaa
accgtcctcccttctatcagaaaaaacggcggggcgaaaatcatcaatatcagcagcatc
agcggactgaccggctttccggcgctttctccgtacgcctcttccaaattcgcgattgaa
gggtttacagagtgtctgcggcttgagctcctgcctttagggattgatgccgctttaata
gaacccggatcctataaaacttcgatttgggagacgtctctctccaatcaaattacggca
cccggtcaagactcgccctattaccgcttttttcagcccattgaagctaacgtcaaagcg
aatgcatcaaaaagcggcgatcccgatgaggtggcagagctgatttatcaattggcacaa
aaaaagcgcctgaagaaactgcggtatccgatcggcaggggcattaagctgacattggct
ttccgttcactcttcccgtggtctgcctgggaatctgttataaagaaaaagctgtttact
taa

DBGET integrated database retrieval system