KEGG   Bacillus amyloliquefaciens XH7: BAXH7_03469Help
Entry
BAXH7_03469       CDS       T01836                                 

Gene name
copZ
Definition
(GenBank) copper chaperone
  KO
K07213  copper chaperone
Organism
bxh  Bacillus amyloliquefaciens XH7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMA
Motif
Other DBs
NCBI-ProteinID: AEK90583
LinkDB All DBs
Position
complement(3227973..3228179)
Genome map
AA seq 68 aa AA seqDB search
MEQKTLQVEGMSCQHCVKAVETGVGELNGVTAVQGNLEAGQVDVTFDEKKVSVSDIKDAI
EDQGYDVV
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaaaacgctgcaagtggaaggcatgtcctgccagcattgcgtcaaagcagta
gagaccggagtaggagaactgaacggagtgacggcggttcaggggaatttggaagccgga
caggtggatgtgacgtttgatgagaagaaagtctccgtatccgatataaaagacgcgatt
gaagatcagggttatgacgtcgtatag

DBGET integrated database retrieval system