KEGG   Bacillus amyloliquefaciens XH7: BAXH7_03528Help
Entry
BAXH7_03528       CDS       T01836                                 

Gene name
pgm2
Definition
(GenBank) phosphoglyceromutase
  KO
K15633  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00010  Glycolysis / Gluconeogenesis
bxh00260  Glycine, serine and threonine metabolism
bxh00680  Methane metabolism
bxh01100  Metabolic pathways
bxh01110  Biosynthesis of secondary metabolites
bxh01120  Microbial metabolism in diverse environments
bxh01130  Biosynthesis of antibiotics
bxh01200  Carbon metabolism
bxh01230  Biosynthesis of amino acids
Module
bxh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bxh_M00002  Glycolysis, core module involving three-carbon compounds
bxh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bxh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAXH7_03528 (pgm2)
  09102 Energy metabolism
   00680 Methane metabolism
    BAXH7_03528 (pgm2)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAXH7_03528 (pgm2)
Enzymes [BR:bxh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     BAXH7_03528 (pgm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: iPGM_N Metalloenzyme Phosphodiest PglZ
Motif
Other DBs
NCBI-ProteinID: AEK90640
LinkDB All DBs
Position
complement(3275767..3277302)
Genome map
AA seq 511 aa AA seqDB search
MSKKPAALIILDGFGLRNETVGNAVAQAKKPNFDRYWNQYPHQTLTASGEAVGLPEGQMG
NSEVGHLNIGAGRIVYQSLTRVNVAIREGEFERNQTFLDAIKNAKDNDKALHLFGLLSDG
GVHSHINHLFALLKLAKSEGLTKVYIHGFLDGRDVGPQTAKTYIQQLNEQIEEIGVGEIA
SISGRYYSMDRDKRWDRVEKAYRAMAYGEGPSYKSAMDVVDDSYANGIHDEFVIPSVITK
ENGEPVAKIHDGDSVIFYNFRPDRAIQISNTFTNKDFRDFDRGENHPKNLHFVCLTHFSE
SVDGYVAFKPVNLDNTVGEVLAQHGLKQLRIAETEKYPHVTFFMSGGREEEFPGEERILI
NSPKVATYDLKPEMSAYEVKDALVKEIAADKHDAIILNFANPDMVGHSGMVEPTIKAIEA
VDECLGEVVDAIIAKGGHAIITADHGNADILITETGEPHTAHTTNPVPVIVTKEGVTLRE
GGILGDLAPTLLDLLGVEKPKEMTGTSLIQK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaaccagctgcactcatcattcttgatgggttcggattacgcaatgaaaca
gtcggaaacgcagtcgcacaagcgaaaaaaccgaatttcgaccgttattggaaccaatac
cctcatcagacgctgacggcatcaggcgaagcagtcggactgcctgaaggacagatgggg
aactctgaagtcggacatttgaatatcggcgccggacgtattgtgtaccaaagcttaaca
cgcgtgaacgttgccatccgcgaaggtgaattcgaacgcaatcaaacgttccttgacgcc
atcaaaaacgcgaaggacaacgacaaagcgctgcacctgttcggtcttctttctgacgga
ggcgtacacagtcatatcaatcatttattcgcgctgctgaagcttgcgaaaagtgaaggg
ctgacgaaggtgtatattcacggtttcctcgacggccgcgatgtaggtccgcaaacagcg
aaaacttacattcagcagctgaatgagcaaatcgaagaaatcggtgtcggcgaaatcgcc
agcatttccggacgctactactccatggaccgcgacaaacgctgggaccgtgtggaaaaa
gcgtaccgcgcaatggcttacggcgaaggcccgtcttacaagagcgcaatggatgtagtg
gacgattcttatgcgaacggcattcatgatgaattcgtcattccgtccgtcatcacaaaa
gaaaacggcgaacctgttgcgaaaattcatgacggcgattctgtaattttctataatttc
agacctgaccgcgccatccagatttcgaacacgtttaccaacaaagatttccgcgatttc
gaccgcggtgaaaatcatccgaaaaacctgcatttcgtctgcctgactcacttcagtgaa
tctgttgacggatatgtggcttttaaaccggtaaaccttgataatacggtcggtgaagta
ttagcacagcacgggttaaaacagcttcgcattgcggaaactgaaaagtatccgcacgtt
acgttctttatgagcggcggccgcgaagaagaattcccgggcgaagagcgcatcctcatt
aactcgccgaaggtcgcaacatatgacctgaagcctgaaatgagcgcgtatgaagtgaag
gatgctcttgtaaaagaaatcgcggctgacaagcacgacgcgatcatcctgaactttgca
aaccctgacatggtcggccactccggaatggtcgaaccgacaattaaagcaattgaagca
gtggacgaatgcttaggcgaagtggttgacgccatcatcgctaaaggcggccacgccatc
attaccgctgatcacggtaatgcagacattctgattacagaaacaggcgaaccgcacact
gcccatacgacaaacccagtccctgtcattgtgacgaaagaaggcgtgacgctgcgcgaa
ggcggaatcctaggcgacctcgcaccaacgttattagaccttctcggtgttgaaaaaccg
aaagaaatgaccggaacatctttaattcaaaaataa

DBGET integrated database retrieval system