KEGG   Bacillus amyloliquefaciens XH7: BAXH7_03549Help
Entry
BAXH7_03549       CDS       T01836                                 

Gene name
yvfI
Definition
(GenBank) putative transcriptional regulator
  KO
K05799  GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex
Organism
bxh  Bacillus amyloliquefaciens XH7
Brite
KEGG Orthology (KO) [BR:bxh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bxh03000]
    BAXH7_03549 (yvfI)
Transcription factors [BR:bxh03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    BAXH7_03549 (yvfI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR HTH_41 HTH_11 HTH_5 TrmB Rrf2 MarR_2 Fe_dep_repress DUF4423 Mo25 HTH_46 DUF2250 RP-C FadR_C HrcA_DNA-bdg HTH_IclR PaaX 2_5_RNA_ligase2 HTH_27 FeoC
Motif
Other DBs
NCBI-ProteinID: AEK90661
LinkDB All DBs
Position
complement(3298082..3298801)
Genome map
AA seq 239 aa AA seqDB search
MKYKQIKTKKIYEEVADALLEKIKAGELKPGEKLDSVQALSESFQVSRSAVREALSALKA
MGLVDMKQGEGTYIKEFEPAHISQPLSSALLMKKEDVKQLLEVRKLLELGVAAMAAEKRT
EEDLQKIRQALMEMKDIDGDEELGEKADFSFHMALAEASQNGLLKHLMNHVSALLLETMR
ETRKIWLFSKQTSVKRLYEEHERIYSAVAAGDADEAEAAMTAHLTNVEEVLGAYFEENV
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatataaacaaattaaaacgaaaaaaatctacgaagaagtcgctgatgcattgctt
gagaagataaaagcgggcgagcttaagccgggtgaaaagcttgattccgttcaggcgctt
tctgagagttttcaggtcagccgctcggcagtcagagaagcgctgtcagctttgaaagcg
atggggctcgtcgacatgaaacagggagaaggcacatacataaaagaatttgaaccggcc
catatttcccagccgctttcttccgccctcttaatgaaaaaagaggacgtcaaacagctg
ctcgaagtcagaaagctgcttgaattgggtgtcgccgccatggccgctgaaaaacgaaca
gaagaagatttacagaaaatccgccaagctctcatggagatgaaagacatcgacggagac
gaagaattgggggaaaaagcagatttctcctttcatatggcgctggcggaagcatcacaa
aacggtctgctcaagcatctcatgaatcatgtctccgcgctgcttttggaaacgatgaga
gaaacgagaaagatttggctgttttctaaacaaacgagcgtgaaaagattatatgaagag
catgaacgcatttacagcgccgtcgccgccggagacgcggatgaagcggaagccgcgatg
acggcgcacctgacgaatgtggaagaagtgctgggggcttattttgaagaaaatgtataa

DBGET integrated database retrieval system