KEGG   Bacillus amyloliquefaciens XH7: BAXH7_03905
Entry
BAXH7_03905       CDS       T01836                                 

Gene name
ywfG
Definition
(GenBank) transaminase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00998  Biosynthesis of various secondary metabolites - part 2
bxh01100  Metabolic pathways
bxh01110  Biosynthesis of secondary metabolites
Module
bxh_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bxh00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BAXH7_03905 (ywfG)
Enzymes [BR:bxh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BAXH7_03905 (ywfG)
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AEK91013
LinkDB
Position
complement(3624053..3625252)
AA seq 399 aa
MEIIPSDVIKTLPKQEFSLVFQKVKELEKTGARIINLGQGNPDLPTPPHIVQSLREAALN
PSYHGYGPFRGYPFLKEAIAEFYEREYGVSVNPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELHEMPLHPENGYLPDFEQIDPAVLKKAKLMFLNYPNNPT
GATADQAFYEKAAAFAKKHDIHLIHDFAYGAFEFDQNPASFLQAKEAKTVGAELYSFSKT
FNMAGWRMAFAVGNEKIIQAVNEFQDHVFVGMFGGLQQAAAAALSGSPEHTERLKRTYQE
RIDFFTELCEKELGWSIEKPKGTFYVWAEIPNEFESSHQFSDYLLEHAHVVVTPGEIFGS
RGKRYVRISMVAKQGDLREFVLRIQKLGLSFASLQGTSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaatcataccgtccgacgtcatcaagacacttccgaaacaggaattttcgctcgtt
tttcaaaaggtaaaagagttggagaaaacgggggcccggatcatcaatctagggcagggg
aatcccgatctccccactccgccgcatatcgttcaatcattgcgggaggctgcgctgaat
ccttcgtatcacggatacggcccgttcagaggctatccgtttctgaaagaagccatcgcg
gaattttatgagagagaatacggtgtatcggtcaatccggagacagaagttgcgctgttc
ggcggaggaaaggcgggtttgtacgttttgacgcaatgcctgctgaatcccggcgacatc
gccttagtcccgaaccccggctaccctgagtatttatcgggaattacaatggccagagcg
gagctgcatgagatgccgcttcatccagagaacggctatctgccggattttgagcagatt
gatcccgccgtcctgaaaaaagcaaagctgatgtttttgaattatccgaataacccgacg
ggcgcgacagcggatcaggcgttttatgaaaaagcggcggcgtttgctaaaaaacatgac
atccatctcattcacgattttgcatacggcgcgttcgaatttgatcagaacccggccagt
tttctccaggcgaaggaagccaagacggtcggcgcggagctgtattcattttcgaaaacc
ttcaatatggcaggctggagaatggcgtttgccgtggggaatgaaaagatcattcaggcg
gtcaatgaatttcaggatcacgtattcgtcggtatgttcggcggccttcagcaggcggca
gcggcggcgctgtcaggaagccctgaacatacagaacggctgaagcgcacatatcaggaa
cggattgattttttcactgagttatgtgaaaaggaattgggctggagtattgaaaagccg
aaagggactttttatgtctgggctgaaattccgaatgaattcgagtcttcacaccaattt
tcggattatctgctggagcatgcccatgttgtcgtgacgcccggcgagattttcggcagc
cgcggaaagcgttatgtcagaatatcaatggtggccaagcagggggacttgagggaattc
gttttgcggattcaaaagctcggtttgtcctttgcttcattacaaggaacatcccgctga

DBGET integrated database retrieval system