KEGG   Bacillus amyloliquefaciens XH7: BAXH7_04129Help
Entry
BAXH7_04129       CDS       T01836                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase (large subunit)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bxh  Bacillus amyloliquefaciens XH7
Brite
KEGG Orthology (KO) [BR:bxh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BAXH7_04129 (ahpF)
Enzymes [BR:bxh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BAXH7_04129 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like Thi4 DAO AlaDh_PNT_C Glutaredoxin NAD_binding_7 FAD_binding_3 NAD_binding_8 K_oxygenase Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AEK91235
LinkDB All DBs
Position
3834022..3835551
Genome map
AA seq 509 aa AA seqDB search
MVLDANIKAQLNQYMQLIENDIVLKVSAGDDDTSKDMLALVDELASMSSKISVEQAELYR
TPSFSVNRAGEDTGVTFAGVPLGHEFTSLVLALLQVSGRAPKADQKVIDQIKNISGEYRF
ESYISLTCHNCPDVVQALNMMSVLNPNITHTMIDGAAFKEEVESKNIMAVPTVFLNGESF
GSGRMTLEEILAKLGSGADASEFADKEPFDVLVVGGGPAGASAAIYTARKGIRTGVVAER
FGGQVLDTMSIENFISVKATEGPKLAASLEEHVKDYDIDVMNLQRAKRLEKKDLFELELE
NGAVLKSKTVILSTGARWRNVNVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTVHKNAQTKEITGDQNVNGITY
IDRETGEEKHVELQGVFVQIGLVPNTEWLDETVERNRIGEIIVDKSGATSVPGLFAAGDC
TDGPYNQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgatgcaaatatcaaagcacaattaaatcaatatatgcagctaattgagaac
gacatcgttctcaaagtaagcgccggtgacgatgacacgtctaaggatatgctggctctc
gttgacgagctggcttccatgtcatctaaaatttcagttgaacaagctgaattatacaga
acaccaagcttcagcgttaatcgtgcaggagaagacacaggcgttacattcgccggtgtt
cctctcggccacgaatttacttcattagtgctcgcattgcttcaagtcagcggcagagcg
cctaaggctgatcaaaaggtcattgaccagattaagaacatcagcggagaataccgcttt
gagtcttatatcagcctgacgtgccacaactgccctgatgttgtccaagcattaaacatg
atgagcgtgcttaacccgaatatcacacatacaatgattgacggcgcggcattcaaagaa
gaagttgaaagcaaaaacatcatggctgttccgactgttttcttaaacggtgaatctttc
ggcagcggccgtatgaccctcgaagagattctcgcgaaattgggcagcggcgcagatgca
tctgagtttgctgacaaagagccgtttgacgttcttgtggtcggcggcggaccggccggc
gcaagcgcggccatctacacggcgcgtaaaggcatccgcacaggtgtcgtcgctgaacgc
ttcggcggtcaggtactcgacaccatgagcatcgaaaacttcatcagcgtcaaagcgact
gaaggaccgaagctcgctgcaagccttgaagagcacgtgaaagattatgatattgacgtc
atgaatctgcagcgcgcgaaacgccttgagaaaaaagacctcttcgaacttgaactcgaa
aacggcgctgtcctgaaaagtaaaacagtgatcctgtcaacaggtgcccgctggcgcaat
gtcaacgtacctggtgagcaagagttcaaaaacaaaggtgtcgcttactgcccgcactgt
gacggaccattgtttgaaggcaaagacgtagcggttatcggcggcggaaactccggaatc
gaagcggcgattgaccttgcaggtatcgtcaatcacgtgactgtgctggagttcgcgcct
gaactgaaagcagacgaagttctgcaaaaacgtctctacagcctgccaaacgtgactgta
cacaaaaatgcacaaacaaaagaaatcacaggcgaccaaaacgtaaacggcatcacgtat
attgaccgtgaaacaggcgaagaaaaacacgttgaactccaaggtgtattcgtccaaatc
ggtctcgtgccaaacacagaatggttagacgaaacggtcgaacgcaaccgcatcggcgaa
atcatcgtcgacaagagcggcgcgacaagcgttcccggcctattcgccgcaggggactgc
acagacggcccgtacaaccaaatcattatctcaatgggatcaggtgcaactgccgcttta
ggcgcatttgattatttgatccggaactag

DBGET integrated database retrieval system