KEGG   Bacillus xiamenensis: BK049_05665Help
Entry
BK049_05665       CDS       T04852                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bxi  Bacillus xiamenensis
Pathway
bxi00473  D-Alanine metabolism
bxi01100  Metabolic pathways
bxi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bxi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BK049_05665
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BK049_05665
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bxi01011]
    BK049_05665
Enzymes [BR:bxi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BK049_05665
Peptidoglycan biosynthesis and degradation proteins [BR:bxi01011]
 Precursor biosynthesis
  Racemase
   BK049_05665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AOZ88227
LinkDB All DBs
Position
complement(1097873..1099051)
Genome map
AA seq 392 aa AA seqDB search
MDTNAFYRDTWAEIDLTAIKHNVSHMKDHIGQNVQLMAVVKANAYGHGDIEVARAALKAG
SDLLAVAFLDEAISLRNKGIKAPILVLGAVPAEYVKVAVKYNVIMTAYSIEWLREVVKVV
QGQMGQPIRFHLKMDSGMNRLGVKTLEQVNEVKELVREHSYLKLEGVFTHFATADEQDED
YFNRQVDTFHTLLQPLRADQLLVHCANSAAGLRFKEVLFNMVRFGISMYGLSPSEEIKDE
LPFKLEEALSLHTKLAHVKLIQKGESVSYGATYTANQDTWIGTVPVGYADGWIRKLAGTE
VLVGGKRRKIAGRVCMDQFMVELKEHMPAGEPVVLIGAQGAEKVSVDEIAKRLETINYEI
TCSIGHRVPRVYIEDGKRVYVRNPLLQDGPNF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggacacaaatgccttttatagagacacatgggcagaaatcgacttaaccgcaatcaag
cataatgtttcacatatgaaagatcatatcggtcaaaacgttcaactgatggctgttgtg
aaagccaatgcatatggtcatggagatatagaagtggcaagagctgccctcaaagcagga
tcagacttgttagccgtagcctttttagatgaggccatttctttaagaaataaaggcatc
aaagcaccgattcttgtactcggcgcagtaccggcagagtatgtcaaagtcgccgtgaaa
tacaacgtgatcatgacagcatactccatcgaatggctgagagaagtggtcaaagtggtg
caagggcagatgggacaaccgattcgtttccacttgaaaatggacagcggcatgaatcgt
ttaggtgttaaaacattagagcaagtcaacgaagtaaaagagcttgtccgcgaacattca
tatttaaagctggaaggtgtatttactcactttgcaacggcggatgaacaggatgaggac
tactttaacagacaggtagatacctttcacacattgcttcagccgcttcgtgcagaccaa
ctgctcgttcattgcgccaacagtgcagcaggtctaaggttcaaagaagtgttgtttaat
atggttcgttttggcatcagtatgtacgggctgtcaccttcagaggaaatcaaagatgaa
ttgccttttaagctggaggaagcattgtctcttcatacaaagcttgcacatgtaaagctc
attcaaaagggtgagagcgtgagctatggagcgacttatacagccaatcaagatacatgg
attggcacggttccagtcggctatgcagacggctggatcaggaagctggcgggaacggaa
gtactcgttggcggaaagcgccggaagatcgctggaagggtatgtatggatcagttcatg
gttgaattgaaagagcacatgccggcaggagagccagtcgttctcatcggagcacaaggc
gcggaaaaggtatcagttgatgaaattgccaaacgacttgaaacgattaactatgaaatc
acttgctctataggtcaccgcgtcccaagagtctatatagaggacggcaaaagggtttat
gtacggaatccgctccttcaagacggaccaaacttttga

DBGET integrated database retrieval system