KEGG   Bacillus xiamenensis: BK049_14215Help
Entry
BK049_14215       CDS       T04852                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bxi  Bacillus xiamenensis
Pathway
bxi00010  Glycolysis / Gluconeogenesis
bxi00030  Pentose phosphate pathway
bxi00051  Fructose and mannose metabolism
bxi00052  Galactose metabolism
bxi00680  Methane metabolism
bxi01100  Metabolic pathways
bxi01110  Biosynthesis of secondary metabolites
bxi01120  Microbial metabolism in diverse environments
bxi01130  Biosynthesis of antibiotics
bxi01200  Carbon metabolism
bxi01230  Biosynthesis of amino acids
bxi03018  RNA degradation
Module
bxi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bxi_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bxi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BK049_14215
   00030 Pentose phosphate pathway
    BK049_14215
   00051 Fructose and mannose metabolism
    BK049_14215
   00052 Galactose metabolism
    BK049_14215
  09102 Energy metabolism
   00680 Methane metabolism
    BK049_14215
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BK049_14215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bxi01009]
    BK049_14215
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bxi03019]
    BK049_14215
Enzymes [BR:bxi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BK049_14215
Protein phosphatases and associated proteins [BR:bxi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BK049_14215
Messenger RNA biogenesis [BR:bxi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BK049_14215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AOZ89740
UniProt: K2NP98
LinkDB All DBs
Position
2790272..2791231
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHNVEVYGIYNGYSGLINGKIEKLEIGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKFGIEGLVVIGGDGSFMGAKKLTELGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVVEVMGRHAGDIALWS
GLAGGAESILIPEADYDMDEIIARLRRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETSL
ETRVSVLGHIQRGGSPSAFDRVLASRLGAYAVELLLEGKGGRCVGIQSNELVHHDILEIL
DKKHTVDQNMYRLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagttttaacgagcggtggggattccccaggaatgaatgcagctgtg
cgcgcagttgtaagaaaagcaatttatcataatgttgaagtttatggtatttataatgga
tattcaggtctaattaacggtaaaattgagaaactcgaaataggttcggtaggcgatatc
attcatcgtggaggaacaaaactttacacggcaagatgtcctgaattcaagacagttgaa
ggccgtgaaaaagggattgaaaacttaaaaaaattcggtatcgaaggacttgttgtcatc
ggtggagatggctcattcatgggagcgaagaaattaacagagctcggttttccatgtgta
ggtgtcccgggcacgattgataacgatattccaggtactgatttcactattggctttgat
acggcacttaatacagtgattgatgccattgataaaattcgtgatacagccacatctcat
gaacgtacatacgtagttgaagtaatgggaagacatgctggagatattgccctttggtca
ggtcttgcgggcggagccgaatccattttgattcctgaggcagactatgacatggacgaa
attattgccaggttgagaagaggacatgagcgcggcaagaagcacagtatcatcatcgta
gcagaaggcgtaggcagcggtgttgaatttggtaagcgaattgaagaggagacaagcctt
gaaacgcgtgtatctgtcttagggcatattcagcgcggaggttctccaagtgcgtttgac
cgagtgctggcaagccgtttaggagcgtatgcagtagaacttcttcttgaaggaaaaggc
ggacgctgtgtaggcattcaaagcaatgaactcgttcaccacgatattttagaaatctta
gataaaaaacatacagtcgatcaaaatatgtaccgactttcacaagagctctctatataa

DBGET integrated database retrieval system