KEGG   Bacillus xiamenensis: BK049_14955Help
Entry
BK049_14955       CDS       T04852                                 

Definition
(GenBank) protein translocase subunit SecDF
  KO
K12257  SecD/SecF fusion protein
Organism
bxi  Bacillus xiamenensis
Pathway
bxi02024  Quorum sensing
bxi03060  Protein export
bxi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bxi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BK049_14955
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BK049_14955
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BK049_14955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bxi02044]
    BK049_14955
Secretion system [BR:bxi02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BK049_14955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD_SecF MMPL Sec_GG KRTDAP
Motif
Other DBs
NCBI-ProteinID: AOZ89874
UniProt: K2MFW1
LinkDB All DBs
Position
2939298..2941526
Genome map
AA seq 742 aa AA seqDB search
MKKGRILAFFLVVLLIGTGVGLLTKPVAKDMTLGLDLQGGFEVLYDVHPVKKEDKITNGV
LVSTVEALNRRANVLGVSEPNISIEGNNRIRVQLAGVKNQNRAREILSTEAQLSFRDTND
KELLNGSDLVENGAKQTFNQTNEPIVTVKLKDAKKFGEVTKKVAAMAPNNQLVIWLDYHK
GDSFKKEVTKSNHKYVSAPNVNQEINSSDVQIEGNFTVQEAKDLASILNAGALPVKLTEK
YSTSVSAQFGEQALNETVFAGIVGIAFIFLFMLLYYRLPGLIAVITLSAYIYITLQVFDW
MGAVMTLPGIAALILGVGMAVDANIITYERIKEELKLGKSVRSAFRSGNRRSFATIFDAN
LTSIIAGGVLFFFGTSSVKGFATMLILSILTSFITAVFLSRFLLGLLVESRYLDRRKGWF
GVRKKDIMNIHETTENTEPKTPFDKWDFVSKRKGFMIFSAAVTIAGIIVLSIFKLNAGID
FASGTRVDVQSDHKLSTEQVEQDFKKLGLETDSVVLSGQKENQAAARFVGVPNKEKIAEV
KDYFKDKYGTEPNVSTVSPTVGKELARNALYAVIIASIGIILYVSVRFEYKMAIAAIISL
LYDAFFIVAFFSITRLEVDVTFIAAILTVIGYSINDTIVTFDRVREQMKKRKPKTIEDLS
HIVNLSLQQTFTRSVNTVLTVLVVVIALLIFGSASITNFSIALLVGLLTGVYSSLYIAAQ
IWLMWKGRELKRPAKVDTEQDI
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagggcgcattcttgcgtttttcttagtggttctgttaatcggaactggtgtg
ggcttattaacgaagcctgttgcgaaagatatgacgctagggctggacttacagggtgga
tttgaagttctgtatgatgtacacccagtgaaaaaagaagacaagatcacaaatggtgtt
ctcgtcagtacagtagaggctttaaaccgaagagccaacgtgcttggagtcagtgagccg
aacatttctattgaaggcaacaaccgtatccgcgtgcagcttgcgggtgtaaaaaatcaa
aacagagcaagagaaattctttcaactgaagctcagctttccttcagagatacgaatgat
aaagagctcttaaacggatctgatcttgttgaaaacggtgcaaaacaaacattcaaccaa
acgaatgagccgattgtgacggtcaaactaaaagatgcgaaaaaatttggcgaagtgaca
aaaaaagtagcggctatggcaccaaataatcagcttgttatttggcttgattatcataag
ggagactccttcaaaaaagaagtcactaaatcaaaccacaagtatgtgtctgcgccgaat
gtgaatcaagagattaacagcagtgacgtacaaattgaagggaactttacggttcaagag
gccaaagaccttgcgagcattttaaatgcaggggcattgccagtaaaattaacggaaaaa
tattcaacatctgtgagtgcacagtttggtgaacaagcactgaacgaaacagtctttgca
ggaattgtaggaatagcatttatcttcttattcatgctgctttattaccgattaccaggt
ctaattgctgtcattacactgtcagcttatatctatatcacactgcaagtttttgactgg
atgggtgcggtcatgacgctgcctggaatcgctgctttgattcttggggtagggatggct
gtcgatgccaatattattacttatgaacggatcaaagaggagctcaagctcggtaaatct
gtgcgttctgccttcaggtcaggaaaccgcagatcatttgccacgatctttgatgcgaac
ttaacaagtattattgccggcggggttctgttcttctttggaacaagttctgtaaaagga
tttgcaaccatgctcatcctatcgattttaacaagctttatcacggctgtcttcctatca
agattcctccttgggcttcttgtagaaagccgttatctcgaccggagaaaaggctggttt
ggcgttcgcaaaaaagacatcatgaacattcatgaaacaacagaaaataccgaaccgaaa
acaccatttgataaatgggatttcgtcagcaaacgtaaaggcttcatgattttctcagca
gccgtgaccattgctggaatcattgtgctttcgatcttcaagctcaatgcaggtattgac
tttgccagtggaacaagggttgatgtccaaagtgatcacaagctgtcaacagagcaagta
gagcaagattttaaaaagcttggtcttgaaacagacagtgttgtgttatcgggtcaaaaa
gaaaatcaggcagctgctcgatttgtcggtgttccgaataaagaaaaaatcgccgaagtg
aaagattacttcaaagataaatatggaactgagcctaacgtaagtacagtgtctccgaca
gtcggaaaagagcttgcacgtaacgcattgtacgcggtcatcattgcttcgatcgggatt
atcttatatgtatccgtccggtttgagtataaaatggccattgcagcgattatctcactg
ctttacgacgcattctttatcgttgccttctttagtattacgcggttagaggtggatgtc
accttcattgcagcgatactcacggtcatcgggtactcgatcaatgacacgatcgtgacc
tttgacagggttcgtgaacaaatgaagaaacgcaaaccgaaaaccattgaagatttatca
catattgtgaacttaagcttacagcaaacctttacgcgttctgtgaacaccgtgctcacc
gtacttgtagtggttattgcactgctcatcttcggatcagcgtctattacaaacttctct
atcgccttacttgttggcctattaacaggggtgtattcatctctttatatcgcggcacaa
atttggctgatgtggaaaggccgtgagctgaaaagaccggctaaagtagacacagaacaa
gacatctaa

DBGET integrated database retrieval system