KEGG   Bacillus xiamenensis: BK049_17610Help
Entry
BK049_17610       CDS       T04852                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bxi  Bacillus xiamenensis
Pathway
bxi00020  Citrate cycle (TCA cycle)
bxi00310  Lysine degradation
bxi00380  Tryptophan metabolism
bxi01100  Metabolic pathways
bxi01110  Biosynthesis of secondary metabolites
bxi01120  Microbial metabolism in diverse environments
bxi01130  Biosynthesis of antibiotics
bxi01200  Carbon metabolism
Module
bxi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bxi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bxi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BK049_17610
  09105 Amino acid metabolism
   00310 Lysine degradation
    BK049_17610
   00380 Tryptophan metabolism
    BK049_17610
Enzymes [BR:bxi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BK049_17610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N Herpes_UL21
Motif
Other DBs
NCBI-ProteinID: AOZ90374
LinkDB All DBs
Position
3424811..3427645
Genome map
AA seq 944 aa AA seqDB search
MFQNNVKQPLSWEEFHGPNLGYVLELYDQYVQDPTSVDEDLRGMFDELGAPPSEMKEEIG
KKENSVVTSEQIQKIASVVKLAEDIRTYGHLNASVNPLRKEKELQELFPLKDYGLTEEDV
KNIPISIISASAPKNISNGIEAINHLRNTYKRTISFEFDHVHDFEERNWLLNSIESGELF
KKKPADKLVSVFKRLTEVEHFEQFLHKTFVGQKRFSIEGLDALVPVLDEIISESVTQGTS
NINIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKELVPSEGSIGISYGWTGDVKYHLG
ADRQIKDEDTKSARVTLANNPSHLEFIDPIIEGSTRAAQESRTQKGYPVQDVEKALAILI
HGDAAFPGEGIVAETLNLSQLDGYQVGGTIHIIANNMIGFTTESNESRSTKYASDLAKGF
EIPIVHVNADDPEACLAAVQLAVEYRKRFKKDFLIDLIGYRRYGHNEMDEPSTTQPMLYD
AVRKHKTVKNIFADKLVSEGLLSKEQREEIEQAVTKKLEEAYKKVPSKKEHTIQEIELPE
PVSNGFPAVDTSVEFDVLRKLNDELISWPKDFQVFGKLKRILEKRAKVFTDDRKVEWSLG
EALAFASILKDGTPIRMTGQDSERGTFAQRNLVLHDSQTGDEFIALHELSDANASFAVHN
SPLSEGSVIGFEYGYNVYSPETLVIWEAQFGDFANAAQVYFDQFISAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSGRTERFLQSAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
VIMTPKSLLRNPNTLSEVQELTDGQFRPVLEQPGLVHDHEKVSRLVLSSGKVSIDISDRF
NQMEEPKDWLHIARVEQLYPFPAKDIKAILTKLVNLEEIVWVQEEPQNMGAWGYIEPYLR
EIASEKVKVRYIGRRRRSSTAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaataatgtgaaacaaccgttgagttgggaagaatttcatggtccgaacctc
ggctacgtgctcgagctctacgatcaatatgtccaggatcctactagtgttgatgaagat
ctaagaggcatgtttgatgaacttggtgcaccaccgagtgaaatgaaggaggaaattggg
aaaaaagaaaatagcgtagttacttctgaacaaatccaaaagatagcatcagtcgttaaa
ctggcagaagacatcagaacgtatggccatttaaatgcttccgtcaatcctcttcgcaaa
gaaaaggaattacaagagctgtttcctttaaaggattacggtttaactgaagaagacgtt
aaaaatattccgatatcaattatcagtgcaagcgcacctaaaaacatttcaaacggcata
gaagccattaaccacctgagaaatacgtataagcgtaccatttcgtttgaatttgatcac
gtgcatgacttcgaagagcgaaactggctcttaaactcgattgaatctggtgaactattt
aagaaaaaaccagctgataaactagtttctgtattcaaaagattaacagaagtcgagcac
ttcgagcagttccttcataaaacatttgtggggcaaaagcgtttttctatagaaggatta
gacgcacttgttccagtactagatgaaattatatcagagtctgttacacaagggacttca
aatattaacattggaatggcacatagaggccgtttaaatgtattagcccatgtattagga
aaaccatatgagatcattttctcagaattccagcatgcgccaaataaagagcttgttcca
tcagaaggctctatcggcatcagctacggatggacaggggatgtgaagtaccatcttggg
gctgatcgtcaaattaaagatgaagatacaaagagtgcgagagtcacacttgccaataac
ccgagtcacttggaatttattgacccgattattgaaggaagcacacgtgctgctcaggaa
tcacgtactcaaaagggctatccagttcaagacgtcgaaaaagcgttagccatcttaatt
catggggatgcagcatttcctggagaaggaattgtagcagaaacattaaatttaagccag
ttggatggctatcaagtaggtggaacgatccacatcattgcaaacaatatgattggattc
acaacggaaagcaatgaatctcgttcaacgaaatacgctagtgaccttgcaaaaggattc
gagattccaattgttcatgtcaatgcagacgatccagaagcatgtttagcggcagttcag
ttagctgtagaataccgcaaacgctttaaaaaggatttcttaattgacttgattggttac
cgcagatacggccataacgaaatggatgagccttcgacaacgcagccaatgctatacgat
gcggtcagaaagcacaaaaccgtcaagaatatctttgcggataagcttgtctcagagggt
cttctgtcaaaagaacaacgagaagaaatcgagcaggctgtaacgaaaaaattagaagaa
gcctataaaaaagtgccttcaaagaaagaacatacgattcaagaaattgaactgccagag
cctgtgtctaatggcttcccagcagtcgatacatccgttgaatttgatgtattaagaaag
ctgaacgatgaattgatcagctggccgaaagacttccaagtattcggtaagctaaaacgg
atccttgaaaaacgtgcaaaggtgtttacagatgaccggaaagtggagtggtcacttggt
gaagcactggcatttgcatctatattaaaagacggtacgccaattcgaatgaccggacag
gattcagagcgaggcacatttgctcaaagaaaccttgttcttcacgacagtcaaacggga
gatgaatttattgctcttcatgaactgagtgatgcaaatgcatcatttgcagtccataac
agtccactgtctgaaggctctgtcatcggatttgaatatggttataatgtctattctcct
gaaacattagtgatttgggaagctcaatttggagacttcgcaaatgcggctcaagtgtat
ttcgatcaatttatttcagcaggccgcgcaaaatggggacaaaaatcaggtcttgtaatg
ctcttgccgcatggatatgaaggacaaggtccagaacattcaagtggaagaacagagcgc
ttcctgcaatcagctgctgagaataactggacagttgcgaacttgacaagtgccgcgcag
tacttccatattcttagaagacaggcgaaaatgctgcttcgtgaagagattcgtccgctt
gtcattatgacaccgaagagtctgcttcgtaacccgaacacattatccgaagtccaagaa
ttaactgacggacagttccgtccagttctggaacagccgggacttgtgcatgatcatgaa
aaagtatcacgcctcgttctatccagcgggaaggtatcaattgatattagtgatcgtttc
aatcaaatggaagagccgaaagattggcttcatattgcgagagtggaacaactatatcca
ttcccagcgaaagatattaaagcaattttaacgaaacttgtgaacttagaagaaatcgtc
tgggtgcaagaagaaccacagaatatgggggcttggggatacatcgagccatatttacgt
gaaattgcgtctgaaaaagtaaaagtgcgttacatcggccgcagaagacgctcaagtacg
gctgagggtgatccaacagtgcataaaaaagaacaagaacgaattgtatctgatagcttg
actcgcaaaaactaa

DBGET integrated database retrieval system