KEGG   Bacillus xiamenensis: BK049_17810Help
Entry
BK049_17810       CDS       T04852                                 

Definition
(GenBank) MFS transporter
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
bxi  Bacillus xiamenensis
Pathway
bxi00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:bxi00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BK049_17810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bxi02000]
    BK049_17810
Transporters [BR:bxi02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    BK049_17810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2 LacY_symp
Motif
Other DBs
NCBI-ProteinID: AOZ90410
LinkDB All DBs
Position
complement(3473763..3474965)
Genome map
AA seq 400 aa AA seqDB search
MKLSELKSSGHPKTLFGAFLYFDVSFMIWVLLGALGAFIAQDFALSTVEKGMIVAIPILS
GSFFRIMLGLLTDRIGPKKTAVMGMLLTTIPLIWGFTAGTTLSELVLIGILLGVAGASFA
VALPMASRWYPPHLQGVAMGIAGAGNSGTLISTLFGPRLAEIYGWHAVMGFALIPLIVVF
LFFIFTAKDAPNQPAPQPLRSYFSVFQVKSTWFFCLLYAITFGGFVGLSSFLSIFFVDQY
AISKIHAGDFVTLCVAAGSFFRPVGGLIADKIGGMKVLLGLFAVIGICLGAVSSLPALPV
VIALLFVGMMCLGMGNGAVFQLVPQVFHKEIGIVTGIVGAAGGIGGFFLPNVLGSIKEMT
GSYTFGFLTISLFVLVVFLCLVLSQLKRKKVVINHTVSES
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactttcagaattaaagtctagtggtcatcctaaaacattgtttggtgcattttta
tattttgatgtgagcttcatgatttgggttttgttaggggcacttggtgcttttattgca
caagattttgccttatcaacagtagaaaaagggatgattgtggccattccgattttatcc
ggctctttttttcgcataatgctggggttattaacagatcgaataggacctaaaaaaacc
gcggtgatgggcatgctgttgaccaccataccgctcatttgggggttcaccgctggtaca
accctttcggagctggtgttgattggtattttactaggagttgcaggtgcaagttttgct
gtcgccttgcctatggcaagccgctggtacccgccacatttacaaggggtggccatgggg
attgcaggtgctggaaacagcggaacactgatctctacgctatttggaccaagacttgcg
gagatttacgggtggcatgcagtgatggggttcgcccttattcccttaattgttgtcttt
ttgttttttattttcactgcgaaagatgcgccaaaccagcccgctcctcagccgctgcgg
tcatatttttcagtctttcaagtgaaatcgacgtggtttttctgccttctttatgcgatt
acattcggaggttttgtcggactttcaagttttttgagtattttcttcgtggatcaatat
gccatttcgaaaatccatgctggtgattttgtgacgctttgtgtagcagcaggcagcttc
tttcggccagttggcggtctaattgccgataaaataggtggaatgaaggttctgcttggc
ttattcgctgtcatcggcatctgcctaggggcagtgagcagtcttcctgctttacctgtg
gttattgcccttttatttgtcgggatgatgtgtcttggcatggggaatggggctgttttt
caactagtgccgcaagtgttccataaggaaattgggattgtgactgggattgttggtgct
gcaggcggcattggcggattctttttaccaaatgttcttggcagtataaaagaaatgact
ggttcgtatacgtttggattcttgaccatttcactttttgtccttgtcgtcttcctctgt
ttagtcttatcacagcttaagcgcaaaaaagtcgtgatcaaccacaccgtttctgaatca
taa

DBGET integrated database retrieval system