KEGG   Bacillus xiamenensis: BK049_17985Help
Entry
BK049_17985       CDS       T04852                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bxi  Bacillus xiamenensis
Pathway
bxi00010  Glycolysis / Gluconeogenesis
bxi00053  Ascorbate and aldarate metabolism
bxi00071  Fatty acid degradation
bxi00280  Valine, leucine and isoleucine degradation
bxi00310  Lysine degradation
bxi00330  Arginine and proline metabolism
bxi00340  Histidine metabolism
bxi00380  Tryptophan metabolism
bxi00410  beta-Alanine metabolism
bxi00561  Glycerolipid metabolism
bxi00620  Pyruvate metabolism
bxi00625  Chloroalkane and chloroalkene degradation
bxi01100  Metabolic pathways
bxi01110  Biosynthesis of secondary metabolites
bxi01120  Microbial metabolism in diverse environments
bxi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bxi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BK049_17985
   00053 Ascorbate and aldarate metabolism
    BK049_17985
   00620 Pyruvate metabolism
    BK049_17985
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BK049_17985
   00561 Glycerolipid metabolism
    BK049_17985
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BK049_17985
   00310 Lysine degradation
    BK049_17985
   00330 Arginine and proline metabolism
    BK049_17985
   00340 Histidine metabolism
    BK049_17985
   00380 Tryptophan metabolism
    BK049_17985
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BK049_17985
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BK049_17985
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BK049_17985
Enzymes [BR:bxi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BK049_17985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh MtaB
Motif
Other DBs
NCBI-ProteinID: AOZ90444
LinkDB All DBs
Position
complement(3515529..3516956)
Genome map
AA seq 475 aa AA seqDB search
MRNQEKHFMNGEWVASTANETTEVINPATEEVIGTISLGTKEDLDKAVKAARAAFPSFSK
TSRHERVEMLENIVRGYEKRKDELVEVMTQELGAPLKVSEEVHYKMGHEHFSKAAEALKS
YTFTEDRGGHTIIKEAIGVSGLITPWNFPTNQTSLKIAGAIAAGSPVVLKPAEITPFAAM
ILAEIIDEAGVPKGVFNLVNGTGEVIGNGISSHPDIDFVSFTGSGAVGSKIMENAAEDIK
KVALELGGKSPLIVLDDADVDEAAETAVHHIAMNTGQVCSAATRVLIPESMKETFEKALL
KALPKFTVGDPREDHATGPLVSKKQWDTVQSYIEKGIEEGATLLAGGTGKPDGIDKGYFA
KHTIFTNVKNDMTIAQEEIFGPVMSVITYQDLDHALEIANDTVYGLAGYVVGKDEKTLKY
VAEHIRAGQITINNAETDYFAPFGGFKQSGIGREWGDFGIEEYLEVKAVMGLPTA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatcaagagaaacactttatgaatggagaatgggtagcatccacagcaaacgaa
acgacggaagtcatcaatcctgctacagaggaagtcattggcacaattagcttaggaacg
aaggaagacttagataaggctgttaaagcagctcgtgccgccttcccttcattctcaaaa
acatctcgacatgaacgagtagagatgctggaaaacattgtgcgcgggtacgaaaagcgt
aaggatgaactagtcgaagtcatgacacaagagctgggtgcaccgcttaaagtatcagaa
gaggttcattacaaaatggggcatgaacacttctctaaagctgcggaagcccttaagtcc
tatacatttacagaagaccgcggtggacatacaattataaaagaagcaattggtgtcagt
ggactcattacaccatggaattttccaacaaaccaaacatcactgaaaatagctggtgcc
attgcggcaggatcaccagtcgtcttaaagcctgctgaaattacaccatttgcagcaatg
attcttgcagaaattattgatgaagcaggtgtgcctaaaggcgtctttaacctagtgaat
ggaacaggtgaagtcattgggaatggcattagctcacatcccgatattgattttgtttca
tttacaggctcaggtgcagtcggttctaaaataatggaaaacgctgctgaagatattaag
aaagtcgcgcttgagcttggcgggaaatcccctcttatcgttttagacgatgcagatgtg
gatgaagcagcagaaacggccgttcatcatattgcgatgaacacaggtcaagtatgctcc
gcagctacacgtgtactgattcctgaatcaatgaaggagacatttgagaaagcactgctg
aaggctctgccgaagtttactgtaggtgatccgagagaagatcacgccactggcccgctt
gtctccaaaaaacaatgggatactgtgcagtcatatattgaaaaaggaatcgaagaaggt
gcgaccttgcttgctgggggaactggaaagccggacggcatagacaaaggctattttgca
aagcatacgatcttcacaaatgtgaaaaatgatatgaccattgcccaagaagaaattttt
ggaccggtgatgagtgtcattacgtatcaggacctagaccatgcccttgaaatcgctaat
gatacagtttatggtcttgctgggtatgtggttggcaaagatgaaaagacattaaaatac
gtcgctgaacacattcgtgctggtcaaatcaccattaacaatgccgaaacagattacttt
gccccatttggcggctttaagcaatcaggtattggcagagaatggggagatttcggtatc
gaggaatatctagaagtcaaagctgtaatgggacttccaacggcgtaa

DBGET integrated database retrieval system