KEGG   Bacteroides xylanisolvens: BXY_19630Help
Entry
BXY_19630         CDS       T02579                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bxy  Bacteroides xylanisolvens
Brite
KEGG Orthology (KO) [BR:bxy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BXY_19630
Enzymes [BR:bxy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BXY_19630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like Thi4 Thioredoxin_3 FAD_oxidored DAO NAD_binding_7 AlaDh_PNT_C NAD_binding_8 FAD_binding_3 PALP K_oxygenase Lycopene_cycl PLD_C
Motif
Other DBs
NCBI-ProteinID: CBK67053
UniProt: D6CY01
LinkDB All DBs
Position
complement(2325227..2326777)
Genome map
AA seq 516 aa AA seqDB search
MLESALKEQLKGIFAGLEANFTFDISVSSSHENKTELLELLGDVADCSDHITCSVNEGEA
LKFTLLKNSDRTGITFRGIPNGHEFTSLLLAILNLDGKGKNFPDEAVCNRVKALKGPIHL
TTYVSLICTNCPDVVQALNAMVTLNPAITHEMVDGALYQDEVDALKIQGVPSVFADGKLL
HVGRGEFGELLAKLEDQYGIDETKANAEVKEYDVIVAGGGPAGVSAAIYSARKGLRVAIV
AERIGGQVKETVGIENLISVPETTGNELADNLKTHLLRYPVDLLEHRKVEKVEVVGKQKQ
ITTSVGEKFLAPALIIATGASWRKLNVPGEAEYIGRGVAFCPHCDGPFYKGKHVAVVGGG
NSGIEAAIDLAGICSKVTVFEFMDELKADSVLQDRLKSLPNVEVFVSSQTTEVIGNGDKL
TALRIKDRKTEEERLVELDGVFVQIGLSANSSVFRDIVETNRSGEIMIDAHCRTNVTGIY
AAGDVSTVPYKQIIISMGEGAKAALSAFDDRVRGII
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttagaatctgcattaaaagaacaactaaagggtatttttgctgggctggaggcaaac
tttacttttgatatatccgtatcatccagccacgaaaacaaaacagaattattggagttg
ctgggagatgtagcggattgttccgatcatatcacttgctcggtgaatgagggagaagca
ttgaagtttactttattaaagaatagtgatcgtaccggaatcacattccggggtattcct
aacggacatgagttcacgtcattgcttttggctatcctgaatctggacggcaaaggaaag
aactttcctgatgaggctgtttgcaaccgtgtgaaagcactgaaaggtccgatacatctg
accacttatgtttcgttgatttgtacgaactgtcctgacgtagtgcaggctctgaatgca
atggtcactttgaatcctgctattactcatgaaatggtagacggcgcgctttatcaggac
gaagtagatgcactgaaaatacaaggagtaccttctgtctttgcagatggaaaattgctt
catgtaggccgtggtgaatttggcgaattgcttgccaagttggaagatcaatatggtatt
gacgaaaccaaagcgaatgcagaggtgaaagaatatgatgtgattgtagccggtggagga
cctgcaggagtatcggcagctatttattctgcccgtaaaggactccgtgtagctattgtg
gccgagcgtattggcggacaggtgaaagaaacggtaggtattgagaatttaatctctgtt
ccggaaacgacaggaaatgaacttgccgataatctgaaaactcacttgttgcgttatccg
gtggatttgctggagcatcgtaaagtagaaaaagtagaagtggttggaaaacaaaagcag
atcactacctctgttggggagaaattcctggctccggcactgattattgcaactggtgca
agctggcgtaaactgaatgttccgggagaagcggagtatatcggtcgtggtgttgctttc
tgccctcattgtgatgggccgttttataagggaaagcatgtagcagtagtaggtggagga
aattccggcattgaggcagcgattgacttggctggtatctgctccaaagtcactgttttt
gaatttatggatgagttgaaagcagacagtgtacttcaagatcgacttaaatcattgccg
aacgtggaagtgtttgtaagttcacagactacggaagtgataggaaatggtgataaactg
actgccctacgcatcaaagatcgtaaaacggaagaagaacgtttggttgagttggatggt
gtatttgtacagatcgggctttctgcgaatagcagtgtattccgcgacatagtggaaacc
aaccgttcgggcgaaatcatgattgatgcacattgccgtacgaatgtgacgggtatctat
gcagctggagatgtttctacggttccttataagcaaatcattatctctatgggcgaagga
gcgaaagctgcgctttctgcatttgacgatagagtgagagggattatctga

DBGET integrated database retrieval system