KEGG   Bacteroides xylanisolvens: BXY_31840Help
Entry
BXY_31840         CDS       T02579                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bxy  Bacteroides xylanisolvens
Pathway
bxy00473  D-Alanine metabolism
bxy01100  Metabolic pathways
bxy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bxy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BXY_31840
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BXY_31840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bxy01011]
    BXY_31840
Enzymes [BR:bxy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BXY_31840
Peptidoglycan biosynthesis and degradation proteins [BR:bxy01011]
 Precursor biosynthesis
  Racemase
   BXY_31840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: CBK68191
UniProt: D6D189
LinkDB All DBs
Position
3976722..3979262
Genome map
AA seq 846 aa AA seqDB search
MSYAIESIAKSIGARRVGKHKATIDWLLTDSRSLSFPEETLFFALTTKRNSGARYIPDLY
DRGVRNFVITEEDFKEVENGELRVESSMQHDGAQPTLNSQLSTLNFLIVPNPLKALQKLA
ETHRDKFKIPVIGITGSNGKTIVKEWLHQLLSPDRCIVRSPRSYNSQIGVPLSVWQLSEE
AELGIFEAGISEMGEMGALKRMIKPTIGILTNIGGAHQENFFSLQEKCMEKLTLFKDCDV
VIYNGDNELISNCVAKSMLTAREIAWSRTDIERPLYISRVTKKEDHTVISYRYLEMDNTF
CIPFIDDASIENALNCLAACLYLMTPADQITERMARLEPIAMRLEVKEGKNNCVLINDSY
NSDLASLDIALDFLVRRSEKKGLKRTLILSDILETGQSTATLYRRVAQLVQSKGINKLIG
VGQEISSCSARFNDDLERYFFPNTEALLASNILKSLHSEVILVKGSRVFNFDLVSEALEL
KVHETILEVNLGAMVANLNHYRSMLRHPETKMICMVKASAYGAGSYEIAKSLQEHHVDYL
AVAVADEGSELRKAGITASIIIMDPELTAFKTMFDYKLEPEVYNFHLLDALIKAAEKEGI
TNFPIHVKLDTGMHRLGFAVEDIPLLIRRLKNQSAVIPRSVFSHFVGSDSSQFDAFTRGQ
IELFEKGSQELQAAFSHKILRHICNTAGIERFPEAQYDMVRLGIGLYGVSPIDNSIIHNV
STLKTTILQIRDVPQEDTVGYSRMGHLVRPSRIAAIPIGYADGLNRHLGRGNAYCLVNGK
KAPYVGNICMDVCMIDVTDIDCREGDQAIIFGDDLPITVLSDKLETIPYEVLTSISTRVK
RVYYQD
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatgcgattgaatccatagccaaaagtatcggtgcccgccgtgtgggcaaacat
aaagcgactattgattggctgctaacagacagccgctctttgagttttccggaagaaact
cttttttttgctttaactaccaaacgaaacagcggagcccgttatatccccgatttatat
gaccggggcgtacgtaattttgtaattacggaagaagactttaaagaagttgagaatgga
gagttgagagttgagagttctatgcagcatgatggtgcgcagcccactctcaattctcaa
ctctcaactctcaacttcctcatcgttcccaatcctctgaaagctttgcagaagcttgct
gaaacacatcgtgataaatttaaaatccctgtgattggtatcaccggcagtaatggaaaa
accattgtgaaggagtggttgcatcagttacttagcccggatcgttgcatcgttcgttct
ccacgcagttataattcgcagatcggagtcccactttctgtgtggcaactttctgaagaa
gccgaactgggtattttcgaagccggcatttccgagatgggggagatgggagctttgaaa
cgaatgattaagcctaccattggtattctgaccaatatcggtggtgcccatcaggaaaac
ttcttctccttgcaggagaaatgcatggaaaagctgacgcttttcaaagactgtgatgtc
gtgatttacaacggtgataacgagttaatcagtaattgtgtcgcaaaatcaatgctgacg
gcgcgtgagattgcctggagccgtaccgacattgaacgcccgttgtatattagccgtgtg
accaagaaagaagatcataccgttatatcttatcgttatctggagatggataatactttc
tgtattcctttcatcgatgacgcttccattgaaaatgcactgaattgtctggcagcttgt
ctttacctgatgacacctgccgaccagataaccgagcggatggcccgtctcgaaccgatt
gccatgcgtctggaggtgaaagaagggaagaataactgtgtactgattaatgatagctac
aattcagacctggcatcattggatattgctctcgatttccttgtacgccgctcggaaaag
aaaggcttgaaacggacgcttatcctgtcggatatactggaaaccggacaaagtaccgct
acgctttatcggcgtgtagcacaattggtacagagcaaagggattaataaactgattgga
gtagggcaggagatatcttcttgttccgcccgttttaatgatgatctcgaacgctatttc
tttcctaacacagaagcactccttgcatccaatatactcaaatcgcttcattcggaagtg
attttggtgaaaggttcccgcgtgttcaactttgatttggtatccgaagccctcgaattg
aaggtgcatgaaaccattcttgaagtaaatctcggggcgatggtagccaacttgaaccat
taccgttctatgcttcgccatccggaaacaaagatgatctgtatggtgaaagcatcagct
tacggagccggttcgtatgaaattgccaagagtttgcaggaacaccatgtcgattatctg
gctgtagccgttgctgacgaaggttccgaactccgcaaggcaggcattaccgcctctatt
atcattatggacccggaacttaccgcattcaaaaccatgtttgattataaactggaaccg
gaagtctataatttccatctgctcgacgcacttatcaaagctgcggagaaagaaggaatc
accaacttccccattcatgtgaaacttgatacaggtatgcaccgtttgggctttgcggta
gaggatattccattgcttatccgtcgactgaagaatcagagcgcggtgattccccgttcg
gtattctctcattttgtaggaagtgattcgtcacagttcgacgctttcacccgcggacag
attgaattgttcgagaaaggttcgcaagaattgcaggccgccttctctcataagattctc
cgtcatatctgtaatacggcaggaatcgaacgtttccccgaagcacagtacgatatggtg
cgcttgggaatcggactttatggagtcagcccgatagacaattcgataatacataatgta
agtacgctcaagactaccatccttcagatccgggatgttcctcaagaagatacggtagga
tatagccggatggggcatttggtacgcccttcacgcattgcagctattcctatcggttat
gcggatggactgaaccgccacttgggacgcggcaacgcctattgcctggtgaacggaaag
aaagctccttatgtagggaatatctgtatggacgtttgcatgatcgatgtgacggatatt
gattgtcgggaaggcgatcaggctatcatcttcggtgatgatctgccgattacggtgttg
tccgataagctggaaacgattccttatgaagtgttgacaagtatatcgacacgggtgaaa
cgggtatattatcaggattaa

DBGET integrated database retrieval system