KEGG   Bacteroides xylanisolvens: BXY_47650Help
Entry
BXY_47650         CDS       T02579                                 

Definition
(GenBank) Glycoside hydrolase 97.
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bxy  Bacteroides xylanisolvens
Pathway
bxy00500  Starch and sucrose metabolism
bxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BXY_47650
Enzymes [BR:bxy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BXY_47650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: CBK69612
UniProt: D6D6A9
LinkDB All DBs
Position
complement(5819578..5821788)
Genome map
AA seq 736 aa AA seqDB search
MKKNLLLIAFFCISFIANAQQKLTSPDGNLVMTFQVNKEGAPTYDLIYKGKTVIKPSTLG
LELKKEDNTRTDFDWVDRRDLTKLDSKTNLYNGFEVKDVKTSTFNETWQPVWGEEKEIHN
HYNELAATLYQPMNDRSILIRFRLFNDGLGFRYEFPQQKSLNYFIIKEEHSQFAMAGDHI
AYWIPGDYDTQEYDYTISRLSEIRGLMKEAITPNSSQTPFSQTGVQTALMMKTDDGLYIN
LHEAALIDYSCMHLNLDDKNMVFESWLTPDAKGDKGYLQTPCNTPWRTVIVSDDARNILA
SRITLNLNEPCKITDAASWVKPVKYIGVWWDMITGKGSWAYTDELTSVKLGETDYSKTKP
NGKHSANTANVKRYIDFAAANGFDAVLVEGWNEGWEDWFGNSKDYVFDFVTPYPDFDVKE
VHRYAASKGIKMMMHHETSASVRNYERHMDKAYQFMVDNGYNSVKSGYVGNIIPRGEHHY
GQWMNNHYLYAVTKAADYKIMVNAHEATRPTGICRTYPNLIGNESARGTEYESFGGNKVY
HTTILPFTRLVGGPMDYTPGIFETHCNKMNPANNSQVRSTIARQLALYVTMYSPLQMAAD
IPENYERFMDAFQFIKDVAIDWDETNYLEAEPGEYITIARKAKGTGDWYVGCTAGENGHT
SKLVFDFLTPGKQYIATVYADAKDADWKENPQAYTIKKGILTNKSKLNLRAANGGGYAIS
IKEVKDKAEVKGLKKF
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaatcttttgcttatcgcatttttctgtatctcgtttatagcgaatgcacaa
cagaaactcacttcgccggatggaaatctagtaatgaccttccaggttaacaaagaaggt
gctccaacgtacgacttgatttataaaggcaaaacggttatcaaaccaagtaccctggga
ctggaattaaagaaagaagataatacccgcacagatttcgactgggtagaccgccgggat
ctgacaaaacttgattcaaagactaatctttataacggattcgaagtgaaagacgtcaag
acttccacattcaacgaaacttggcaaccggtatggggagaagaaaaagaaatccacaat
cattataacgaactggcagccacgctgtatcagcccatgaacgaccgttctatccttatc
cgtttccggttgttcaacgatggtttaggattccgctacgaattcccgcagcagaaatct
ctgaactacttcatcatcaaagaagaacattcccagtttgcaatggcaggcgaccacatc
gcttactggataccgggcgactatgacactcaggaatatgattacactatctcccgcctg
tcagaaatcagaggtttgatgaaagaagccattactccgaactcttctcagactcctttc
tcacagacaggcgtacagactgcactgatgatgaaaacggatgacggtttatatatcaat
cttcacgaagctgctctcatcgattactcatgtatgcacctgaatctggacgacaaaaat
atggtattcgaatcctggctgactccggatgctaaaggagacaaaggttatctgcaaact
ccctgtaatactccgtggcgtaccgttatcgtcagcgatgatgcccgcaatattcttgca
tcccgcatcactctgaacctgaatgagccatgcaaaatcacagatgccgcttcatgggtg
aagcctgtgaaatatatcggcgtatggtgggatatgattaccggaaaaggttcatgggct
tataccgacgaactgactagcgtaaaactgggagaaacggattactctaaaaccaaaccg
aacggcaaacattctgccaacactgccaacgtgaaacgctatattgacttcgccgcagca
aacgggttcgacgctgtattggtagaaggctggaatgaaggttgggaagactggttcggc
aatagcaaggactatgtattcgacttcgtcactccgtatccggatttcgatgtaaaagaa
gtacatcgttacgcagcgagcaaaggtatcaagatgatgatgcaccacgaaacttccgca
tctgtccgcaactacgaacgccatatggacaaggcttaccagtttatggtagacaacggt
tacaattctgtaaagagcggttatgtaggcaatatcattccgcgcggcgaacaccactac
ggacaatggatgaacaaccactacctgtatgcagtgacgaaagcagccgactacaaaatc
atggtaaatgctcacgaagcaacccgcccgacaggtatctgccgcacgtatcctaactta
atcggcaacgaatccgcacgcggaaccgaatacgaatcattcggcggaaacaaagtatat
cacacaactatacttcctttcacccgtttggtcggcggcccgatggattacactccgggt
atcttcgaaactcattgtaacaagatgaatcctgcaaacaattcacaggtacgttctacc
atcgcccgccagttagccttgtacgtgaccatgtacagcccgctgcaaatggctgccgat
attcctgaaaactacgaacgtttcatggatgctttccaattcatcaaagacgtggcaatc
gactgggacgaaacaaactatctggaagcagaaccgggagaatatatcactatcgcccgt
aaggcaaaaggtacaggcgactggtatgtaggttgtacagccggtgagaacggtcatact
tccaaactggtattcgacttcctcacaccgggaaaacaatacattgccactgtttatgcg
gatgctaaagatgccgactggaaagaaaatccgcaagcttataccatcaaaaaaggtatc
ctgacaaacaaaagcaaactgaacttgcgcgctgccaacggtggcggttatgccatcagt
atcaaggaagtaaaggataaagcggaagtaaaaggactaaagaaattttag

DBGET integrated database retrieval system