KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_0576Help
Entry
BANAU_0576        CDS       T02050                                 

Gene name
bdhA
Definition
(GenBank) acetoin reductase/2,3 butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BANAU_0576 (bdhA)
Enzymes [BR:bya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BANAU_0576 (bdhA)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BANAU_0576 (bdhA)
    1.1.1.-  
     BANAU_0576 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C PALP F420_oxidored
Motif
Other DBs
NCBI-ProteinID: CCG48598
LinkDB All DBs
Position
complement(616845..617885)
Genome map
AA seq 346 aa AA seqDB search
MKAARWHNQKDIRIENIDEPKAEPGKVKIKVKWCGICGSDLHEYLGGPIFIPVGKPHPLT
NEMAPVTMGHEFSGEVVEVGEGVKNYSVGDRVVVEPIFATHGHQGAYNLDEQMGFLGLAG
GGGGFSEYVSVDEELLFKLPEELSYEQGALVEPSAVALYAVRQSKLKAGDKAAVFGCGPI
GLLVIEALKAAGATDIYAVELSPERQEKAKELGAIIIDPSKTDDVVEEIAKRTNGGVDVS
YEVTGVPVVLRQAIQSTNIAGETVIVSIWEKGAEIHPNDIVIKERTVKGIIGYRDIFPSV
LALMKEGYFSADKLVTKKIVLDDLIEEGFGALIKEKNQVKILVKPN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggcaagatggcacaatcaaaaagacattcgaatcgaaaacattgatgaacct
aaagcagaaccgggtaaagtcaaaattaaagtcaaatggtgcgggatttgcggaagcgac
cttcatgaatatttgggaggcccgatctttattccggtcggcaaacctcatccgttaaca
aacgaaatggcgcccgtcacgatgggtcacgaattctcaggagaagtcgttgaagtgggc
gaaggcgtcaaaaattacagcgtcggcgaccgtgtcgtcgtggaaccgatttttgccaca
cacggacatcagggagcctataaccttgatgaacaaatgggattcttaggcttagccgga
ggcggcggcggattttctgaatatgtatccgttgacgaagaattgctgtttaagcttcct
gaagagctttcttacgaacagggcgcgcttgttgagccgtcagcggtagcgctttacgcc
gtccgccaaagcaaattaaaagcgggcgacaaggcggcagtttttggctgcggaccgatc
gggctgcttgtgattgaagccctgaaagcggccggcgccacagatatttacgcggttgaa
ctttcaccggaacgtcaggaaaaagcgaaagaactcggcgctatcatcattgatccgtca
aaaacggacgatgtcgttgaagaaatcgctaaacgcacaaacggcggcgttgatgtttct
tatgaagtaacaggcgttcctgtcgttctccgccaggcaatccagtcaacaaacattgcc
ggtgaaacggttatcgtcagcatctgggaaaaaggagcggaaattcatccgaacgatatc
gtcatcaaagaacggaccgtaaaaggcattatcggataccgtgacatcttcccttccgtt
cttgcactgatgaaagagggctacttctcagcagataagctcgtcacgaaaaaaatcgtg
ctcgacgatctgattgaagaaggctttggcgctttaatcaaagagaaaaaccaagtgaaa
atcttagtcaaaccgaactaa

DBGET integrated database retrieval system